DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E5 and NKX6-3

DIOPT Version :9

Sequence 1:NP_524825.1 Gene:E5 / 45396 FlyBaseID:FBgn0008646 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001351770.1 Gene:NKX6-3 / 157848 HGNCID:26328 Length:265 Species:Homo sapiens


Alignment Length:247 Identity:74/247 - (29%)
Similarity:96/247 - (38%) Gaps:54/247 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   198 AQF-QMAAALAHHHQQQQQQQQQQLPPVPTGP------PHG-----PHPHLPPGQIPLGIFPGGP 250
            ||| :|.|.:.   |...|....:|.|...||      |||     ..|...|..   .:..|.|
Human    17 AQFPEMKAPVC---QYSVQNSFYKLSPPGLGPQLAAGTPHGITDILSRPVAAPNN---SLLSGYP 75

  Fly   251 HPG-----------HPPPHGHHPFGSAPHLIRDSYPL----------YPWLLSRHGRIFPRFPGN 294
            |..           :.|..|:  |..|    .:.||.          ..|   |.||.....| :
Human    76 HVAGFGGLSSQGVYYSPQVGN--FSKA----GNEYPTRTRNCWADTGQDW---RGGRQCSNTP-D 130

  Fly   295 FLFQPFRKPKRVRTAFSPTQLLKLEHAFEGNHYVVGAERKQLAQGLSLTETQVKVWFQNRRTKHK 359
            .|.....|.|..|..|:..|:..||..||...|:.|.||.:||..|.:||:||||||||||||.:
Human   131 PLSDSIHKKKHTRPTFTGHQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWR 195

  Fly   360 RMQQEGGDGSDTKSNKGSSSGGGGGGDGEDDAKHDGSQHSYEDAEDPEDEDE 411
            :.     ...:..|:...:.||.|.|.|.|.|..:.....|....||:.:||
Human   196 KK-----SALEPSSSTPRAPGGAGAGAGGDRAPSENEDDEYNKPLDPDSDDE 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E5NP_524825.1 Homeobox 307..359 CDD:278475 28/51 (55%)
NKX6-3NP_001351770.1 Homeobox 142..195 CDD:306543 28/52 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.