DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E5 and Emx2

DIOPT Version :9

Sequence 1:NP_524825.1 Gene:E5 / 45396 FlyBaseID:FBgn0008646 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_034262.2 Gene:Emx2 / 13797 MGIID:95388 Length:253 Species:Mus musculus


Alignment Length:343 Identity:118/343 - (34%)
Similarity:143/343 - (41%) Gaps:132/343 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 PKLAFSIDSIVGESSTRSAPLRVSVISSPPPRSESPASPTNTNNSGRRTPRGYIYCRRRDSLDRS 112
            ||..|:|:|:|.:.|    ||       |..|||.|..|.                    :|..:
Mouse     6 PKRCFTIESLVAKDS----PL-------PASRSEDPIRPA--------------------ALSYA 39

  Fly   113 RSPQRSPVSRSPSPPNAGGNPAAAGNTAKSGDPSSGTG---NPPTLIRPLPLPAPNLALIGNRTS 174
            .|   ||:           ||...|..:.:...::|.|   ||..:........||.|:      
Mouse    40 NS---SPI-----------NPFLNGFHSAAAAAAAGRGVYSNPDLVFAEAVSHPPNPAV------ 84

  Fly   175 PNAMAVRMAGPPHPPSQPPPFLAAQFQMAAALAHHHQQQQQQQQQQLPPVPTGPPHGPHPHLPPG 239
                      |.||  .|||.         |||.|             |:|:.  |.|||.....
Mouse    85 ----------PVHP--VPPPH---------ALAAH-------------PLPSS--HSPHPLFASQ 113

  Fly   240 QIPLGIFPGGPHPGHPPPHGHHPFGSAPHLIRDSYPLYPWLLSRHGRIFPRFPGN------FLFQ 298
            |                              ||....||||:.|:..:..||.||      ||..
Mouse   114 Q------------------------------RDPSTFYPWLIHRYRYLGHRFQGNDTSPESFLLH 148

  Fly   299 P--FRKPKRVRTAFSPTQLLKLEHAFEGNHYVVGAERKQLAQGLSLTETQVKVWFQNRRTKHKR- 360
            .  .|||||:||||||:|||:||||||.|||||||||||||..||||||||||||||||||.|| 
Mouse   149 NALARKPKRIRTAFSPSQLLRLEHAFEKNHYVVGAERKQLAHSLSLTETQVKVWFQNRRTKFKRQ 213

  Fly   361 -MQQEGGDGSDTKSNKGS 377
             :::||.|....|  ||:
Mouse   214 KLEEEGSDSQQKK--KGT 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E5NP_524825.1 Homeobox 307..359 CDD:278475 46/51 (90%)
Emx2NP_034262.2 Homeobox 159..212 CDD:395001 46/52 (88%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 213..253 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 104 1.000 Domainoid score I6697
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000921
OrthoInspector 1 1.000 - - mtm8781
orthoMCL 1 0.900 - - OOG6_109182
Panther 1 1.100 - - O PTHR24339
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3162
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.800

Return to query results.
Submit another query.