Sequence 1: | NP_524825.1 | Gene: | E5 / 45396 | FlyBaseID: | FBgn0008646 | Length: | 524 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_034185.1 | Gene: | Dlx3 / 13393 | MGIID: | 94903 | Length: | 287 | Species: | Mus musculus |
Alignment Length: | 205 | Identity: | 57/205 - (27%) |
---|---|---|---|
Similarity: | 80/205 - (39%) | Gaps: | 51/205 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 234 PHLPPGQI-PLGIFPGGPH---PGHP------PPHGHHPF------GSAPHLIRDSYPLYPWLLS 282
Fly 283 RHGRIFPRFPGNFLFQPF--------------------RKPKRV---RTAFSPTQLLKLEHAFEG 324
Fly 325 NHYVVGAERKQLAQGLSLTETQVKVWFQNRRTKHKRMQQEGGDGSDTKSNKGSSSGGGGGGDGED 389
Fly 390 DAKHDGSQHS 399 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
E5 | NP_524825.1 | Homeobox | 307..359 | CDD:278475 | 26/51 (51%) |
Dlx3 | NP_034185.1 | DLL_N | 27..107 | CDD:315147 | 18/85 (21%) |
Abdominal-A | <109..224 | CDD:332641 | 39/117 (33%) | ||
Interaction with DNA. /evidence=ECO:0000250|UniProtKB:O60479 | 131..181 | 23/49 (47%) | |||
Homeobox | 132..185 | CDD:306543 | 26/52 (50%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 195..287 | 7/31 (23%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0850 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |