DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E5 and Dlx2

DIOPT Version :9

Sequence 1:NP_524825.1 Gene:E5 / 45396 FlyBaseID:FBgn0008646 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_034184.1 Gene:Dlx2 / 13392 MGIID:94902 Length:332 Species:Mus musculus


Alignment Length:383 Identity:87/383 - (22%)
Similarity:114/383 - (29%) Gaps:177/383 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 QMAAALAHHHQQQQQQQQQQLPPVPTGPPHGP------------------HPHLPPG-------- 239
            |:.|:..:|..||.          |:|...||                  .|.||..        
Mouse    16 QITASSTYHQHQQP----------PSGAGAGPGGNSNSSSSNSSLHKPQESPTLPVSTATDSSYY 70

  Fly   240 ---QIPLGIFPGGPHP-GHPPPHGHH---------------------------PFGSAPHLIR-- 271
               |.|.|...||..| .|...:.:|                           |:|::...:.  
Mouse    71 TNQQHPAGGGGGGASPYAHMGSYQYHASGLNNVSYSAKSSYDLGYTAAYTSYAPYGTSSSPVNNE 135

  Fly   272 -DSYPLYPWLLSRHGRIFPRFPGNFLFQPFRKPKRV---RTAFSPTQLLKLEHAFEGNHYVVGAE 332
             |...|.|.:...:|                |||:|   ||.:|..||..|:..|:...|:...|
Mouse   136 PDKEDLEPEIRIVNG----------------KPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPE 184

  Fly   333 RKQLAQGLSLTETQVKVWFQNRRTKHKRMQQEGGDGSDTKSNKGSSS------------------ 379
            |.:||..|.||:||||:||||||:|.|:|.:.|  ...|:.:.|:|:                  
Mouse   185 RAELAASLGLTQTQVKIWFQNRRSKFKKMWKSG--EIPTEQHPGASASPPCASPPVSAPASWDFG 247

  Fly   380 -----GGGGGGDGEDDAKHDGSQHS------------YEDAEDPEDEDEIEEDDEDEVIDMDDYG 427
                 .|||.|.|...|...||..|            |..|.                      |
Mouse   248 APQRMAGGGPGSGGGGAGSSGSSPSSAASAFLGNYPWYHQAS----------------------G 290

  Fly   428 SEMDAEEHQRLREQFQQQLAQHQQQFMQQNAGEAATLSPQQQHQLLQQHQQHLQQQHH 485
            |                  |.|.|       ..|..|.|.|..|....|..|    ||
Mouse   291 S------------------ASHLQ-------ATAPLLHPSQTPQAHHHHHHH----HH 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E5NP_524825.1 Homeobox 307..359 CDD:278475 26/51 (51%)
Dlx2NP_034184.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..83 14/73 (19%)
DLL_N 54..135 CDD:289198 13/80 (16%)
Homeobox 158..211 CDD:278475 26/52 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..272 11/52 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 304..332 7/20 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.