DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E5 and dlx4

DIOPT Version :9

Sequence 1:NP_524825.1 Gene:E5 / 45396 FlyBaseID:FBgn0008646 Length:524 Species:Drosophila melanogaster
Sequence 2:XP_002935758.3 Gene:dlx4 / 100494171 XenbaseID:XB-GENE-876742 Length:253 Species:Xenopus tropicalis


Alignment Length:223 Identity:67/223 - (30%)
Similarity:89/223 - (39%) Gaps:67/223 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 HPPSQPPPFLAAQFQMAAALAHHHQQQQQQQQQQLPPVPTGPPHG--PHPHLPPGQIPLGIF-PG 248
            |.|:..|     |.|.:.||||.|.                |.||  |..|       .|:| ||
 Frog    21 HGPTSSP-----QSQHSPALAHGHY----------------PLHGFLPTAH-------EGLFSPG 57

  Fly   249 GPHPGH---PPPHG---------HHPFGSAPHLIRDSYPLYPWLLSRHGRIFP------------ 289
            .|..|.   |.|:.         ||..||| :|   :|..|...:....|:..            
 Frog    58 TPSFGGRTLPYPYASSSHHHQQQHHHNGSA-YL---NYQQYTSTIGSSARLHEDQEMEKSTVIEN 118

  Fly   290 ---RFPGNFLFQPFRKPKRVRTAFSPTQLLKLEHAFEGNHYVVGAERKQLAQGLSLTETQVKVWF 351
               |..|.  .:..|||   ||.:|..||..|...|:...|:...||.:||..|.||:||||:||
 Frog   119 GEIRINGK--GKKIRKP---RTIYSSLQLQALNQRFQQTQYLALPERAELAAQLGLTQTQVKIWF 178

  Fly   352 QNRRTKHKRMQQEGGDGSDTKSNKGSSS 379
            ||:|:|:|::.:.|....|......||:
 Frog   179 QNKRSKYKKVMKHGSSVQDEDQPASSSA 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E5NP_524825.1 Homeobox 307..359 CDD:278475 25/51 (49%)
dlx4XP_002935758.3 COG5576 98..239 CDD:227863 36/114 (32%)
Homeobox 133..187 CDD:395001 26/56 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.