DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E5 and emx2

DIOPT Version :9

Sequence 1:NP_524825.1 Gene:E5 / 45396 FlyBaseID:FBgn0008646 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001128284.1 Gene:emx2 / 100038069 XenbaseID:XB-GENE-481028 Length:247 Species:Xenopus tropicalis


Alignment Length:380 Identity:124/380 - (32%)
Similarity:145/380 - (38%) Gaps:150/380 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 PKLAFSIDSIVGESSTRSAPLRVSVISSPPPRSESPASPTNTNNSGRRTPRGYIYCRRRDSLDRS 112
            ||..|:|:|:|.:.|    ||.||       |||.|..|.                    :|..:
 Frog     6 PKRCFTIESLVAKDS----PLPVS-------RSEEPIRPA--------------------ALSYA 39

  Fly   113 RSPQRSPVSRSPSPPNAG--GNPAAAGNTAKSGDPSSGTGNPPTLIRPLPLPAPNLALIGNRTSP 175
            .|...:|......|...|  .||......|.|..|     ||...:.|:|               
 Frog    40 NSAPMNPFLNGFHPTGRGVYSNPDLVFAEAVSHPP-----NPAVPVHPVP--------------- 84

  Fly   176 NAMAVRMAGPPHPPSQPPPFLAAQFQMAAALAHHHQQQQQQQQQQLPPVPTGPPHGPHPHLPPGQ 240
                     |||                 |||.|             |:||.  |.|||.....|
 Frog    85 ---------PPH-----------------ALAAH-------------PLPTS--HSPHPLFASQQ 108

  Fly   241 IPLGIFPGGPHPGHPPPHGHHPFGSAPHLIRDSYPLYPWLLSRHGRIFPRFPGN------FLFQP 299
                                          ||....||||:.|:..:..||.||      ||...
 Frog   109 ------------------------------RDPSTFYPWLIHRYRYLGHRFQGNDTSAESFLLHN 143

  Fly   300 --FRKPKRVRTAFSPTQLLKLEHAFEGNHYVVGAERKQLAQGLSLTETQVKVWFQNRRTKHKR-- 360
              .|||||:||||||:|||:||||||.|||||||||||||..||||||||||||||||||.||  
 Frog   144 ALARKPKRIRTAFSPSQLLRLEHAFEKNHYVVGAERKQLAHSLSLTETQVKVWFQNRRTKFKRQK 208

  Fly   361 MQQEGGDGSDTKSNKGSSSGGGGGGDGEDDAKHDGSQHSYEDAEDPEDEDEIEED 415
            :::||.|.|..|  ||              |.|............||:.|...:|
 Frog   209 LEEEGSDSSQKK--KG--------------AHHINRWRLATKQASPEEIDVTSDD 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E5NP_524825.1 Homeobox 307..359 CDD:278475 46/51 (90%)
emx2NP_001128284.1 Homeobox 153..206 CDD:365835 46/52 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 104 1.000 Domainoid score I6622
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000921
OrthoInspector 1 1.000 - - mtm9445
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3162
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.030

Return to query results.
Submit another query.