DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E5 and not

DIOPT Version :9

Sequence 1:NP_524825.1 Gene:E5 / 45396 FlyBaseID:FBgn0008646 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001164669.1 Gene:not / 100038059 XenbaseID:XB-GENE-478518 Length:236 Species:Xenopus tropicalis


Alignment Length:239 Identity:73/239 - (30%)
Similarity:91/239 - (38%) Gaps:74/239 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 PPHPPSQP----------PPFLAAQFQMAAALAHHHQQQQQQQQQQLPPVPTGPPHGPHPHLPPG 239
            ||.|||.|          ||.    :.:...:.:....|||         |...|.|..|...|.
 Frog    59 PPSPPSVPYRYSYGMMPYPPV----WLIKPTVGYPSMAQQQ---------PMRMPRGECPCPDPA 110

  Fly   240 QIPLGIFPGGPHPGHPPPHGHHPFGSAPHLIRDSYPLYPWLLSRHGRIFPRFPGNFLFQPFRKPK 304
            ....|:.           :.|.|.||...|        .|   |.|..              |.|
 Frog   111 CKERGLL-----------YSHCPNGSMNPL--------SW---RTGPC--------------KMK 139

  Fly   305 RVRTAFSPTQLLKLEHAFEGNHYVVGAERKQLAQGLSLTETQVKVWFQNRRTKHKRMQQEGGDGS 369
            |:||.|:|.||.:||..|....|:||.||..||..|:||||||||||||||.|.::...|     
 Frog   140 RIRTVFTPEQLERLEKEFLKQQYMVGTERVDLASTLNLTETQVKVWFQNRRIKWRKQSLE----- 199

  Fly   370 DTKSNKGSSSGGGGGGDGEDDAKHDGSQHSYEDAEDPEDEDEIE 413
             .|..|.|..|         ....|.|.|:.:..|..||||:::
 Frog   200 -QKKAKLSQFG---------VIPADSSDHTDDSRETEEDEDDVD 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E5NP_524825.1 Homeobox 307..359 CDD:278475 32/51 (63%)
notNP_001164669.1 Homeobox 142..194 CDD:278475 32/51 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000921
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.