DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E5 and cdx1b

DIOPT Version :9

Sequence 1:NP_524825.1 Gene:E5 / 45396 FlyBaseID:FBgn0008646 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001092232.1 Gene:cdx1b / 100004956 ZFINID:ZDB-GENE-070615-29 Length:255 Species:Danio rerio


Alignment Length:234 Identity:60/234 - (25%)
Similarity:87/234 - (37%) Gaps:72/234 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 HQQQQQQQQQQLPPVPTGPPHGPHPHLPPGQIPLGIFPGGPH--------PGHPPPHGH-HPFG- 264
            |.......|..:|..|..|....:.|:|      ||....||        |.:|||... .|:| 
Zfish    20 HPSLNLNPQNFVPAPPQYPDFTGYHHVP------GITTNDPHHSQTGSWNPAYPPPREEWTPYGP 78

  Fly   265 ----------------------SAPHLIRDSYPLYPWLLSRHGRIFP----RFPGNFLFQPF--- 300
                                  ..|.|::.|      :.|..|::.|    |.|.:::.:..   
Zfish    79 GSGVSSSSTGQLGFSPPEFSSVQTPGLLQSS------INSSVGQLSPNAQRRNPYDWMRRSVPPA 137

  Fly   301 ------RKPKRVRTAFSPTQLLKLEHAFEGNHYVVGAERKQLAQGLSLTETQVKVWFQNRRTKH- 358
                  |...:.|..::..|.|:||..|..:.|:....:.:||..|||:|.|||:||||||.|. 
Zfish   138 SSGGKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKAELATALSLSERQVKIWFQNRRAKER 202

  Fly   359 ----KRMQQEGGDGSDTKSNKGS----------SSGGGG 383
                |:|||.....:.|.:..||          ||..||
Zfish   203 KINKKKMQQPQPASTTTPTPPGSALPGNVPMVTSSSSGG 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E5NP_524825.1 Homeobox 307..359 CDD:278475 23/56 (41%)
cdx1bNP_001092232.1 Caudal_act 13..132 CDD:282574 25/123 (20%)
Homeobox 150..202 CDD:278475 23/51 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.