DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ogre and inx-10

DIOPT Version :9

Sequence 1:NP_001245557.1 Gene:ogre / 45382 FlyBaseID:FBgn0004646 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001024139.1 Gene:inx-10 / 188580 WormBaseID:WBGene00002132 Length:559 Species:Caenorhabditis elegans


Alignment Length:327 Identity:84/327 - (25%)
Similarity:143/327 - (43%) Gaps:74/327 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLGSLKSYLKWQDIQTD-NAVFRLHNSFTTVLLLTCSLIITATQYVGQPISCIVNGVPPHVVNT- 66
            :|.::.|.|::.....| :.|.|||:.||..||:..:::::..|:.|:|:.|:|    |.:.:: 
 Worm     2 VLAAVLSMLRYVGGSDDRDFVDRLHSYFTCNLLIGLAVLVSFKQFGGKPVECLV----PDIFSSS 62

  Fly    67 -------FCWIHSTFTMPDAFRRQVGREVAHPGVANDFGDEDAKKYYTYYQWVCFVLFFQAMACY 124
                   :||...|:.:|           .:..||....||..::..:|||||.|.|..:| ||:
 Worm    63 WEQYAENYCWASDTYYVP-----------TNEPVAGLQSDEKRQRKISYYQWVPFFLLLEA-ACF 115

  Fly   125 -TPKFLWNKFEGGLMRMIVMGLNITICTR----------EEKEAKRDALLDYL-----------I 167
             .|..||....|.      .|:.|....:          :.|.|...:|..:|           .
 Worm   116 RLPSLLWKYLAGH------SGIKINEIVKLSSDPNNIKPDIKRANIKSLTVHLQGALRFHRRLQK 174

  Fly   168 KHVKRHKL-------YAIRYWACEFLC-----CINIIVQMYLMNRFFDGE---FLSYGTNIMKLS 217
            |.::.|:.       |:..:....:||     ..|:.:|:..||||.:.:   :...|..:..|:
 Worm   175 KQIRPHRFLWLFNLPYSAFFVTAMYLCTKFFYLANVCLQLMFMNRFLETDKYKWYGMGALVDLLN 239

  Fly   218 DVPQEQRVDPMVYVFPRVTKCTFHKYGPSGSLQKHDSLCILPLNIVNEKTYVFIWFWFWILLVLL 282
            ....||.     .:||||:.|.| .....|::|:|...|:|.:||.|||.::.:|||:..|||..
 Worm   240 GTTWEQS-----GMFPRVSLCDF-DVRVMGNMQEHTIQCVLVINIFNEKIFILLWFWYLALLVFT 298

  Fly   283 IG 284
            .|
 Worm   299 FG 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ogreNP_001245557.1 Innexin 20..351 CDD:279248 81/311 (26%)
inx-10NP_001024139.1 Innexin 20..380 CDD:279248 80/309 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 133 1.000 Domainoid score I3133
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I3152
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG28980
OrthoDB 1 1.010 - - D323554at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4755
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11893
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X282
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.080

Return to query results.
Submit another query.