DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ogre and inx-6

DIOPT Version :9

Sequence 1:NP_001245557.1 Gene:ogre / 45382 FlyBaseID:FBgn0004646 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_502435.1 Gene:inx-6 / 178231 WormBaseID:WBGene00002128 Length:389 Species:Caenorhabditis elegans


Alignment Length:285 Identity:72/285 - (25%)
Similarity:125/285 - (43%) Gaps:51/285 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RLHNSFTTVLLLTCSLIITATQYVGQPISCIV----NGVPPHVVNTFCWIHSTFTMPDAFRRQVG 85
            ||::..|.|:|...|.::.::.::|.||:|..    |....:.||.:|::|.|:.:|      :.
 Worm    29 RLNSRVTVVILAVSSALLLSSHFIGDPITCWTPAQFNAQWVNFVNQYCFVHGTYFVP------LD 87

  Fly    86 REVAHPGVANDFGDEDAKKY-YTYYQWVCFVLFFQAMACYTPKFLWNKFEGGLMRMIVMGLNITI 149
            :::|       |.:|:..|. ..|||||.:|...||...|.|:|:|...      :...|.::..
 Worm    88 QQLA-------FEEEERTKVSIQYYQWVPYVFALQAFLFYIPRFIWKAM------IAYSGYDLAA 139

  Fly   150 CTR------EEKEAKRDALLDYL----------------IKHVKRHKLYAIRYWACEFLCCINII 192
            ..:      .|...|.|.....|                :...||.:..|:.|........:|..
 Worm   140 AVKYVDRFWSENRDKDDKFKTRLAAFEGRPSVYIWDGIRLARKKRSRNMALFYTLSTVWQAVNAW 204

  Fly   193 VQMYLMNRFFDGE-FLSYGTNIMKLSDVPQEQRVDPMVYVFPRVTKCTFHKYGPSGSLQKHDSLC 256
            :|.|::.:..|.. :..:|.:|  |.|:.|........: |||:..|.|::..|: |:|....||
 Worm   205 IQFYILTQLLDSSIYTLWGPSI--LGDLLQGNDWQTTGH-FPRIVHCDFNRRRPA-SVQLDTVLC 265

  Fly   257 ILPLNIVNEKTYVFIWFWFWILLVL 281
            :|.|||..||.::|:|||...:.|:
 Worm   266 VLTLNIYYEKLFIFLWFWLVFVAVV 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ogreNP_001245557.1 Innexin 20..351 CDD:279248 72/285 (25%)
inx-6NP_502435.1 Innexin 25..364 CDD:395704 72/285 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 133 1.000 Domainoid score I3133
eggNOG 1 0.900 - - E1_2BWHM
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I3152
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG28980
OrthoDB 1 1.010 - - D323554at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4755
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11893
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X282
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.980

Return to query results.
Submit another query.