DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fwd and AT1G51040

DIOPT Version :9

Sequence 1:NP_001356971.1 Gene:fwd / 45374 FlyBaseID:FBgn0004373 Length:1682 Species:Drosophila melanogaster
Sequence 2:NP_175516.1 Gene:AT1G51040 / 841525 AraportID:AT1G51040 Length:525 Species:Arabidopsis thaliana


Alignment Length:263 Identity:97/263 - (36%)
Similarity:150/263 - (57%) Gaps:17/263 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly  1416 SAIVKCGDDLRQELMATQLLQMFKIIWQEEQVDLWVRPYKIVCLSNDSGLIEPIL-NTVSLHQIK 1479
            :.|.|.|||.||:::|.|::.:...|:|...::|::.||         |::..:: ||.|..|:.
plant   273 ACIFKVGDDCRQDVLALQVISLLGDIFQAVGLNLYLFPY---------GVLPTVVPNTRSRSQMG 328

  Fly  1480 KNSNKSLKEYFIDEYGSPSGESFRRAQKNFVQSCAAYCLISYLLQVKDRHNGNILFHSDGHIIHI 1544
            :.::..|.|.|...||.....:|..|:.||:.|.|.|.:.|.|||.|||||||:||...|.::||
plant   329 ETTDGGLYEIFQQNYGLVGSTTFETARANFLISSAGYAVASLLLQPKDRHNGNLLFDDVGRLVHI 393

  Fly  1545 DFGFILSISP-KNLGFEQSPFKLTPEFVEVM---GGTSSEHWREFNKLLLVGMMSARKHMDRIIN 1605
            ||||||..|| .|:.||.:.|||:.|..:::   |...|:.|.:|..|.:.|.::||::||.||:
plant   394 DFGFILETSPGGNMRFENAHFKLSHEMTQLLDPSGVMKSKTWHQFVSLCVKGYLAARRYMDEIIS 458

  Fly  1606 FVEIMRSNAHLPCFKNGCSGTVQNLRKRFHMNLTEQEMERKVEQLVQDSLKSLSTKLYDGYQYYT 1670
            .|::|..:. ||||..|  ..:.|||||||..::|:|....:..:..|:....:|..||..||..
plant   459 TVQMMLESG-LPCFSRG--DPIGNLRKRFHPEMSEREAALFMINVCTDAYNKWTTAGYDLIQYLQ 520

  Fly  1671 NGI 1673
            .|:
plant   521 QGV 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fwdNP_001356971.1 PI4Kc_III_beta 1385..1674 CDD:270712 97/263 (37%)
AT1G51040NP_175516.1 PI3Ka <116..172 CDD:294194
PI4Kc_III_alpha 233..524 CDD:270711 97/263 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1147978at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.