DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fwd and Atr

DIOPT Version :9

Sequence 1:NP_001356971.1 Gene:fwd / 45374 FlyBaseID:FBgn0004373 Length:1682 Species:Drosophila melanogaster
Sequence 2:XP_003750609.1 Gene:Atr / 685055 RGDID:1305796 Length:2636 Species:Rattus norvegicus


Alignment Length:338 Identity:72/338 - (21%)
Similarity:140/338 - (41%) Gaps:89/338 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly  1410 SNWRLLSAIVKCGDDLRQELMATQLLQMFKII-------WQEEQVDLWVRPYKIVCLSNDSGLIE 1467
            |:.:....:.|..||||::   .:|::...:|       .:..:.:|.:|.|.::.|:::.|:||
  Rat  2309 SDGKFYIMMCKPKDDLRKD---CRLMEFNSLINKSLRKDAESRRRELHIRTYAVIPLNDECGIIE 2370

  Fly  1468 PILNTVSLHQIKKN---------SNKSLK------------------------------EYFIDE 1493
            .:.||..|..|...         :.|.|:                              |:|:..
  Rat  2371 WVNNTAGLRPILTKLYKEKGVYMTGKELRQCMLPKSAALSEKLKVFQEILLPRHPPVFHEWFLRT 2435

  Fly  1494 YGSPSGESFRRAQKNFVQSCAAYCLISYLLQVKDRHNGNILFHS-DGHIIHIDFGFILSISPKNL 1557
            :..|:  |:..::..:.:|.|...::.|:|.:.|||..||||.| .|..:|:||..:.:   |..
  Rat  2436 FPDPT--SWYSSRSAYCRSTAVMSMVGYILGLGDRHGENILFDSFTGECVHVDFNCLFN---KGE 2495

  Fly  1558 GFEQS---PFKLTPEFVEVMGGTSSEH-WREFNKLLLVGMMSARKHM---------DRIINFVEI 1609
            .||..   ||:||...|..||...:|. :|...::.|..|...|:.:         |.::.:.:.
  Rat  2496 TFEVPEIVPFRLTHNMVNGMGPMGTEGLFRRACEVTLRLMRDQREPLMSVLKTFLHDPLVEWSKP 2560

  Fly  1610 MRSNAHLPCFKNGCSGTVQNLRKRFHMNLTEQEM-----------------ERKVEQLVQDSL-K 1656
            ::.::..|..:   :|.|.|.:.:.|:...||.:                 |..|..|:|::. :
  Rat  2561 VKGHSKAPPNE---TGEVVNEKAKTHVLDIEQRLQGVIKTRNRVTGLPLSIEGHVHYLIQEATDE 2622

  Fly  1657 SLSTKLYDGYQYY 1669
            :|..::|.|:..|
  Rat  2623 NLLCQMYLGWTPY 2635

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fwdNP_001356971.1 PI4Kc_III_beta 1385..1674 CDD:270712 72/338 (21%)
AtrXP_003750609.1 UME 1120..1226 CDD:214825
FAT 1766..2087 CDD:280429
TEL1 <2118..2636 CDD:227365 72/338 (21%)
PIKKc_ATR 2285..2559 CDD:270625 57/257 (22%)
FATC 2605..2636 CDD:280430 8/31 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.