Sequence 1: | NP_001356971.1 | Gene: | fwd / 45374 | FlyBaseID: | FBgn0004373 | Length: | 1682 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001373429.1 | Gene: | MTOR / 2475 | HGNCID: | 3942 | Length: | 2549 | Species: | Homo sapiens |
Alignment Length: | 245 | Identity: | 54/245 - (22%) |
---|---|---|---|
Similarity: | 99/245 - (40%) | Gaps: | 48/245 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 1410 SNWRLLSAIVKCGDDLRQELMATQLLQMFKIIWQEE----QVDLWVRPYKIVCLSNDSGLIEPIL 1470
Fly 1471 NTVSLHQIKKNSNKSLK-----------------------------EYFIDEYG----------- 1495
Fly 1496 SPSGESFRRAQKNFVQSCAAYCLISYLLQVKDRHNGNILF-HSDGHIIHIDFGFILSISPKNLGF 1559
Fly 1560 -EQSPFKLTPEFVEVMGGTSSEHWREFNKLLLVGMMSARKHMDRIINFVE 1608 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
fwd | NP_001356971.1 | PI4Kc_III_beta | 1385..1674 | CDD:270712 | 54/245 (22%) |
MTOR | NP_001373429.1 | Interaction with NBN. /evidence=ECO:0000269|PubMed:23762398 | 1..651 | ||
TEL1 | 363..2549 | CDD:227365 | 54/245 (22%) | ||
HEAT 16 | 637..683 | ||||
HEAT repeat | 655..681 | CDD:293787 | |||
HEAT 17 | 686..724 | ||||
HEAT repeat | 691..721 | CDD:293787 | |||
HEAT 18 | 727..766 | ||||
HEAT repeat | 729..759 | CDD:293787 | |||
HEAT 19 | 769..811 | ||||
HEAT repeat | 772..805 | CDD:293787 | |||
HEAT 20 | 814..853 | ||||
HEAT repeat | 817..847 | CDD:293787 | |||
HEAT 21 | 857..893 | ||||
HEAT 22 | 894..942 | ||||
HEAT 23 | 943..988 | ||||
HEAT repeat | 955..981 | CDD:293787 | |||
HEAT 24 | 989..1027 | ||||
HEAT repeat | 993..1021 | CDD:293787 | |||
HEAT 25 | 1029..1068 | ||||
HEAT repeat | 1033..1062 | CDD:293787 | |||
HEAT 26 | 1069..1105 | ||||
HEAT repeat | 1073..1099 | CDD:293787 | |||
HEAT 27 | 1106..1144 | ||||
HEAT repeat | 1111..1142 | CDD:293787 | |||
HEAT 28 | 1145..1188 | ||||
HEAT repeat | 1154..1180 | CDD:293787 | |||
HEAT 29 | 1189..1225 | ||||
HEAT 30 | 1226..1273 | ||||
HEAT 31 | 1274..1311 | ||||
HEAT 32 | 1312..1345 | ||||
TPR 1 | 1346..1382 | ||||
TPR 2 | 1383..1408 | ||||
TPR 3 | 1409..1442 | ||||
TPR 4 | 1443..1473 | ||||
TPR 5 | 1474..1507 | ||||
TPR 6 | 1508..1541 | ||||
TPR 7 | 1542..1574 | ||||
TPR 8 | 1575..1614 | ||||
TPR 9 | 1615..1649 | ||||
TPR 10 | 1650..1693 | ||||
TPR 11 | 1694..1731 | ||||
TPR 12 | 1732..1786 | ||||
TPR 13 | 1787..1846 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1812..1867 | ||||
TPR 14 | 1898..1930 | ||||
TPR 15 | 1931..1970 | ||||
TPR 16 | 1971..2005 | ||||
Sufficient for interaction with the FKBP1A/rapamycin complex. /evidence=ECO:0000250 | 2012..2144 | ||||
Interaction with MLST8 | 2258..2296 | 2/37 (5%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5032 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |