DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fwd and age-1

DIOPT Version :9

Sequence 1:NP_001356971.1 Gene:fwd / 45374 FlyBaseID:FBgn0004373 Length:1682 Species:Drosophila melanogaster
Sequence 2:NP_496462.2 Gene:age-1 / 174762 WormBaseID:WBGene00000090 Length:1182 Species:Caenorhabditis elegans


Alignment Length:423 Identity:97/423 - (22%)
Similarity:164/423 - (38%) Gaps:120/423 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly  1329 RKVSERDTISQISLDSCDSRDQGPPVVFNIGDVRLRHCSNLSCENTKSFS------NDPEDP--- 1384
            |:|...|.:::||     :..:|.|.  ::..::||       :..:|.|      :.|.||   
 Worm   798 RQVDMVDELTRIS-----TLVKGMPK--DVATMKLR-------DELRSISHKMENMDSPLDPVYK 848

  Fly  1385 -------SAAAL---KEP----WHEKEKLIRESSPYGHLSNWRLLSAIVKCGDDLRQELMATQLL 1435
                   .|..|   |.|    |..|........|:        .:.|.|.||||||:::..|:|
 Worm   849 LGEMIIDKAIVLGSAKRPLMLHWKNKNPKSDLHLPF--------CAMIFKNGDDLRQDMLVLQVL 905

  Fly  1436 QMFKIIWQEEQVDLWVRPYKIVCLSNDSGLIEPILNTVSLHQI---------------------- 1478
            ::...||:...:|..:.||.::.:....|:||.:.|..::.:|                      
 Worm   906 EVMDNIWKAANIDCCLNPYAVLPMGEMIGIIEVVPNCKTIFEIQVGTGFMNTAVRSIDPSFMNKW 970

  Fly  1479 --------------KKNSNK-----------SLKEYFIDEYGSPSGESFRRAQKNFVQSCAAYCL 1518
                          ||:|.|           ::|:||         ||..|    |:.||..|.:
 Worm   971 IRKQCGIEDEKKKSKKDSTKNPIEKKIDNTQAMKKYF---------ESVDR----FLYSCVGYSV 1022

  Fly  1519 ISYLLQVKDRHNGNILFHSDGHIIHIDFGFILSISPKNLGF--EQSPFKLTPEFVEVM-GGTS-- 1578
            .:|::.:||||:.|::...||...|||||.||......||.  ::.||.||..|:.|: .|.|  
 Worm  1023 ATYIMGIKDRHSDNLMLTEDGKYFHIDFGHILGHGKTKLGIQRDRQPFILTEHFMTVIRSGKSVD 1087

  Fly  1579 --SEHWREFNKLLLVGMMSARKHMDRIINFVEIMRSNAHLPCFKNGCSGTVQNLRKRFHMNLTEQ 1641
              |...::|..|.:........:.|..::...:| ....||  :......:.:|:|....|...:
 Worm  1088 GNSHELQKFKTLCVEAYEVMWNNRDLFVSLFTLM-LGMELP--ELSTKADLDHLKKTLFCNGESK 1149

  Fly  1642 EMERK-----VEQLVQDSLKSLSTKLYDGYQYY 1669
            |..||     .|:....|..:.:..|:...::|
 Worm  1150 EEARKFFAGIYEEAFNGSWSTKTNWLFHAVKHY 1182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fwdNP_001356971.1 PI4Kc_III_beta 1385..1674 CDD:270712 83/351 (24%)
age-1NP_496462.2 PI3K_p85B 98..177 CDD:197539
PI3K_rbd 241..360 CDD:197540
C2_PI3K_like 420..574 CDD:176026
PI3Ka 606..798 CDD:214537 97/423 (23%)
PKc_like 793..1181 CDD:304357 96/420 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.