DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fwd and BOLA2-SMG1P6

DIOPT Version :9

Sequence 1:NP_001356971.1 Gene:fwd / 45374 FlyBaseID:FBgn0004373 Length:1682 Species:Drosophila melanogaster
Sequence 2:NP_001307551.1 Gene:BOLA2-SMG1P6 / 107282092 HGNCID:53563 Length:305 Species:Homo sapiens


Alignment Length:140 Identity:31/140 - (22%)
Similarity:56/140 - (40%) Gaps:35/140 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   965 LDPYLTIRCRKSVDFSLKCLWLLEAYNYQVDSLGNSHNSSRKSKLALMKEIFSKREHKQTQNDLK 1029
            |||.:||.|...:.:.|.     :..|.|  :.|..:..|..:.|.|:.|        |....|.
Human   143 LDPSMTIHCDMVITYGLD-----QLENCQ--TCGTDYIISVLNLLTLIVE--------QINTKLP 192

  Fly  1030 SAGTGGLHVGEPRSVVALAKKTHHRSQSDATVLLADFRSPHTLSISHRMYQQPPYTTQTLPT--T 1092
            |:....|.:  |.|.:...:  :|:.:             ..::::|.:| |...:.:.:|.  |
Human   193 SSFVEKLFI--PSSKLLFLR--YHKEK-------------EVVAVAHAVY-QAMLSLKNIPVLET 239

  Fly  1093 PAKLCLGDLT 1102
            ..||.||::|
Human   240 AYKLILGEMT 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fwdNP_001356971.1 PI4Kc_III_beta 1385..1674 CDD:270712
BOLA2-SMG1P6NP_001307551.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.