DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shu and fklB

DIOPT Version :10

Sequence 1:NP_611837.1 Gene:shu / 45360 FlyBaseID:FBgn0003401 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_418628.4 Gene:fklB / 948726 ECOCYCID:G7865 Length:206 Species:Escherichia coli


Alignment Length:133 Identity:37/133 - (27%)
Similarity:58/133 - (43%) Gaps:23/133 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 RALMSE----IDENIYK------------RITRTGHVDREAVPNKA-RVSVRYSGYWEGETAPFD 122
            :|:.:|    ::||..|            |:...|   ..|:|.:. ||.|.|:|.....|. ||
E. coli    78 QAMAAEGVKYLEENAKKEGVNSTESGLQFRVINQG---EGAIPARTDRVRVHYTGKLIDGTV-FD 138

  Fly   123 SSLLRGSKFVFETGQGTVVEGLEVAVRSMRPYEQAEFIISYKLLFGELGCPPRIKPKADALFKVE 187
            ||:.||....|..  ..|:.|...|:..|....:.|..|..:|.:||.|....|.|.:..:|:||
E. coli   139 SSVARGEPAEFPV--NGVIPGWIEALTLMPVGSKWELTIPQELAYGERGAGASIPPFSTLVFEVE 201

  Fly   188 VID 190
            :::
E. coli   202 LLE 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shuNP_611837.1 FKBP_C 96..189 CDD:459735 30/93 (32%)
TPR repeat 218..257 CDD:276809
TPR 230..>389 CDD:440225
TPR repeat 262..295 CDD:276809
TPR repeat 304..329 CDD:276809
fklBNP_418628.4 PRK11570 1..206 CDD:183207 37/133 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.