DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shu and fkpA

DIOPT Version :10

Sequence 1:NP_611837.1 Gene:shu / 45360 FlyBaseID:FBgn0003401 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_417806.1 Gene:fkpA / 947850 ECOCYCID:G7716 Length:270 Species:Escherichia coli


Alignment Length:195 Identity:48/195 - (24%)
Similarity:85/195 - (43%) Gaps:29/195 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 EVDNSQQNHARDLGLDSDSDSDYE-DALD--VDGEELRSPWTYSFDELRALMSEIDENIYKRITR 91
            |::.:.|  |.:..:.|.:.:..| ||.|  ..|:|.|.    .|.:.:.:.:.....:| ::..
E. coli    97 EIEQTLQ--AFEARVKSSAQAKMEKDAADNEAKGKEYRE----KFAKEKGVKTSSTGLVY-QVVE 154

  Fly    92 TGHVDREAVPNKARVSVRYSG-YWEGETAPFDSSLLRGSKFVFETGQGTVVEGLEVAVRSMRPYE 155
            .|  ..||..:...|.|.|.| ..:|:  .||:|..||....|..  ..|:.|....:::::...
E. coli   155 AG--KGEAPKDSDTVVVNYKGTLIDGK--EFDNSYTRGEPLSFRL--DGVIPGWTEGLKNIKKGG 213

  Fly   156 QAEFIISYKLLFGELGCPPRIKPKADALFKVEVIDYSLIGDAKGIDAIPQEDRDKFCVVYPKAVD 220
            :.:.:|..:|.:|:.|. |.|.|.:..:|.||::|   :..|...||.|:.|        .||.|
E. coli   214 KIKLVIPPELAYGKAGV-PGIPPNSTLVFDVELLD---VKPAPKADAKPEAD--------AKAAD 266

  Fly   221  220
            E. coli   267  266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shuNP_611837.1 FKBP_C 96..189 CDD:459735 25/93 (27%)
TPR repeat 218..257 CDD:276809 2/3 (67%)
TPR 230..>389 CDD:440225
TPR repeat 262..295 CDD:276809
TPR repeat 304..329 CDD:276809
fkpANP_417806.1 PRK10902 1..259 CDD:236791 43/178 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.