DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shu and AT1G18170

DIOPT Version :9

Sequence 1:NP_611837.1 Gene:shu / 45360 FlyBaseID:FBgn0003401 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_564048.1 Gene:AT1G18170 / 838396 AraportID:AT1G18170 Length:247 Species:Arabidopsis thaliana


Alignment Length:154 Identity:37/154 - (24%)
Similarity:54/154 - (35%) Gaps:53/154 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 IDENIYKRI--------TRTGHVDREAV-PNKARVSVRYSGYWE----GETAPFDSSL------- 125
            |.|.|..||        ||....::|.| ||..|       |::    |...|....|       
plant    93 ISEQIKTRIEVSQEVANTRDVEEEKEIVLPNGIR-------YYDQRVGGGATPRAGDLVVIDLKG 150

  Fly   126 -LRGSKFVFETGQGT---------------------VVEGLEVAVRSMRPYEQAEFIISYKLLFG 168
             ::|:..||....||                     :.||::..:|||:...:...|:...|.||
plant   151 QVQGTGQVFVDTFGTKDKKKMKPLALVVGSKPYSKGLCEGIDYVLRSMKAGGKRRVIVPPSLGFG 215

  Fly   169 ----ELGCPPRIKPKADALFKVEV 188
                ||....:|.|.|...:.||:
plant   216 VDGAELESGLQIPPNASLEYIVEI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shuNP_611837.1 FKBP_C 96..189 CDD:278674 30/131 (23%)
TPR repeat 218..257 CDD:276809
TPR repeat 262..295 CDD:276809
TPR repeat 304..329 CDD:276809
AT1G18170NP_564048.1 FKBP_C 134..239 CDD:395196 23/104 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.