DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shu and AT1G18170

DIOPT Version :10

Sequence 1:NP_611837.1 Gene:shu / 45360 FlyBaseID:FBgn0003401 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_564048.1 Gene:AT1G18170 / 838396 AraportID:AT1G18170 Length:247 Species:Arabidopsis thaliana


Alignment Length:154 Identity:37/154 - (24%)
Similarity:54/154 - (35%) Gaps:53/154 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 IDENIYKRI--------TRTGHVDREAV-PNKARVSVRYSGYWE----GETAPFDSSL------- 125
            |.|.|..||        ||....::|.| ||..|       |::    |...|....|       
plant    93 ISEQIKTRIEVSQEVANTRDVEEEKEIVLPNGIR-------YYDQRVGGGATPRAGDLVVIDLKG 150

  Fly   126 -LRGSKFVFETGQGT---------------------VVEGLEVAVRSMRPYEQAEFIISYKLLFG 168
             ::|:..||....||                     :.||::..:|||:...:...|:...|.||
plant   151 QVQGTGQVFVDTFGTKDKKKMKPLALVVGSKPYSKGLCEGIDYVLRSMKAGGKRRVIVPPSLGFG 215

  Fly   169 ----ELGCPPRIKPKADALFKVEV 188
                ||....:|.|.|...:.||:
plant   216 VDGAELESGLQIPPNASLEYIVEI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shuNP_611837.1 FKBP_C 96..189 CDD:459735 30/131 (23%)
TPR repeat 218..257 CDD:276809
TPR 230..>389 CDD:440225
TPR repeat 262..295 CDD:276809
TPR repeat 304..329 CDD:276809
AT1G18170NP_564048.1 FKBP_C 134..239 CDD:459735 23/104 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.