DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shu and FKBP12

DIOPT Version :10

Sequence 1:NP_611837.1 Gene:shu / 45360 FlyBaseID:FBgn0003401 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_201240.1 Gene:FKBP12 / 836556 AraportID:AT5G64350 Length:112 Species:Arabidopsis thaliana


Alignment Length:109 Identity:32/109 - (29%)
Similarity:57/109 - (52%) Gaps:6/109 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 IYKRITRTGHVDREAVPNKARVSVRYSGYW-EGE-TAPFDSSLLRGSK-FVFETGQGTVVEGLEV 146
            :.|::.|.|:..:.| |.:. |:|..:|:. :|: :..|.|:...|.| |.|:.|:|.|::|.:.
plant     3 VEKQVIRPGNGPKPA-PGQT-VTVHCTGFGKDGDLSQKFWSTKDEGQKPFSFQIGKGAVIKGWDE 65

  Fly   147 AVRSMRPYEQAEFIISYKLLFGELGCPP-RIKPKADALFKVEVI 189
            .|..|:..|.|....|....:|..|.|. .|:|.:...|::||:
plant    66 GVIGMQIGEVARLRCSSDYAYGAGGFPAWGIQPNSVLDFEIEVL 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shuNP_611837.1 FKBP_C 96..189 CDD:459735 28/96 (29%)
TPR repeat 218..257 CDD:276809
TPR 230..>389 CDD:440225
TPR repeat 262..295 CDD:276809
TPR repeat 304..329 CDD:276809
FKBP12NP_201240.1 FkpA 6..111 CDD:440311 31/106 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.