DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shu and FKBP53

DIOPT Version :10

Sequence 1:NP_611837.1 Gene:shu / 45360 FlyBaseID:FBgn0003401 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_567717.1 Gene:FKBP53 / 828637 AraportID:AT4G25340 Length:477 Species:Arabidopsis thaliana


Alignment Length:160 Identity:42/160 - (26%)
Similarity:75/160 - (46%) Gaps:10/160 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 DNSQQNHARDLGLDSDSDSDYEDALDVDGE-ELRSPWTYSFDELRALMSEIDENIYKRITRTGHV 95
            |.|.:...::......||    :|.::.|. |.::|......::|...:.:   |.:.::.....
plant   325 DKSAEKKTKNKKKKKPSD----EAAEISGTVEKQTPADSKSSQVRTYPNGL---IVEELSMGKPN 382

  Fly    96 DREAVPNKARVSVRYSGYWEGETAPFDSSLLRGSKFVFETGQGTVVEGLEVAVRSMRPYEQAEFI 160
            .:.|.|.|. |||||.|..:.....|||::.: |.|.|..|.|:|::|.:|.|..||..::.:..
plant   383 GKRADPGKT-VSVRYIGKLQKNGKIFDSNIGK-SPFKFRLGIGSVIKGWDVGVNGMRVGDKRKLT 445

  Fly   161 ISYKLLFGELGCPPRIKPKADALFKVEVID 190
            |...:.:|..|...:|.|.:...|.||:|:
plant   446 IPPSMGYGVKGAGGQIPPNSWLTFDVELIN 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shuNP_611837.1 FKBP_C 96..189 CDD:459735 31/92 (34%)
TPR repeat 218..257 CDD:276809
TPR 230..>389 CDD:440225
TPR repeat 262..295 CDD:276809
TPR repeat 304..329 CDD:276809
FKBP53NP_567717.1 NPL 3..96 CDD:465511
FKBP_C 384..474 CDD:459735 31/91 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.