DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shu and AT3G55520

DIOPT Version :10

Sequence 1:NP_611837.1 Gene:shu / 45360 FlyBaseID:FBgn0003401 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_191111.1 Gene:AT3G55520 / 824717 AraportID:AT3G55520 Length:190 Species:Arabidopsis thaliana


Alignment Length:140 Identity:36/140 - (25%)
Similarity:61/140 - (43%) Gaps:28/140 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 DALDVDGEELRSPWTYSFDELRALMSEIDENIYKRITRTGHVD----REAVPNKARVSVRYSGYW 114
            ||:|:.|                     |..:.|:|.|:...|    .:.:|   .|.|.|.|..
plant     3 DAIDLSG---------------------DGGVLKKIVRSAKPDAISPSDDLP---VVDVHYEGIL 43

  Fly   115 EGETAPFDSSLLRGSKFVFETGQGTVVEGLEVAVRSMRPYEQAEFIISYKLLFGELGCPPRIKPK 179
            ..:...||::......|.||.|.|:|:...::|:::|:..|.|:.....:..:|..|.||.|.|.
plant    44 AEDEKVFDTTREDNLVFSFELGTGSVIRSWDIALKTMKVGEVAKITCKPEYAYGRAGSPPDIPPD 108

  Fly   180 ADALFKVEVI 189
            |..:|:||::
plant   109 ATLIFEVELV 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shuNP_611837.1 FKBP_C 96..189 CDD:459735 28/96 (29%)
TPR repeat 218..257 CDD:276809
TPR 230..>389 CDD:440225
TPR repeat 262..295 CDD:276809
TPR repeat 304..329 CDD:276809
AT3G55520NP_191111.1 FKBP_C 34..118 CDD:459735 26/83 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.