DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shu and FKBP15-1

DIOPT Version :10

Sequence 1:NP_611837.1 Gene:shu / 45360 FlyBaseID:FBgn0003401 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_566762.1 Gene:FKBP15-1 / 822115 AraportID:AT3G25220 Length:153 Species:Arabidopsis thaliana


Alignment Length:85 Identity:28/85 - (32%)
Similarity:41/85 - (48%) Gaps:1/85 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 RVSVRYSGYWEGETAPFDSSLLRGSKFVFETGQGTVVEGLEVAVRSMRPYEQAEFIISYKLLFGE 169
            ::.|.|.|.....|. ||||..||....||.|.|.|:.|.:..:......|:.:..|..||.:|:
plant    54 KIKVHYRGKLTDGTV-FDSSFERGDPIEFELGTGQVIPGWDQGLLGACVGEKRKLKIPSKLGYGD 117

  Fly   170 LGCPPRIKPKADALFKVEVI 189
            .|.||:|...|..:|..|::
plant   118 NGSPPKIPGGATLIFDTELV 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shuNP_611837.1 FKBP_C 96..189 CDD:459735 28/83 (34%)
TPR repeat 218..257 CDD:276809
TPR 230..>389 CDD:440225
TPR repeat 262..295 CDD:276809
TPR repeat 304..329 CDD:276809
FKBP15-1NP_566762.1 FkpA 48..139 CDD:440311 28/85 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.