DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment shu and FKBP10

DIOPT Version :9

Sequence 1:	NP_611837.1	Gene:	shu / 45360	FlyBaseID:	FBgn0003401	Length:	455	Species:	Drosophila melanogaster
Sequence 2:	XP_011523401.1	Gene:	FKBP10 / 60681	HGNCID:	18169	Length:	601	Species:	Homo sapiens

Alignment Length:	99	Identity:	29/99 - (29%)
Similarity:	50/99 - (50%)	Gaps:	5/99 - (5%)

- Green bases have known domain annotations that are detailed below.

  Fly   108 VRYSGYWEG---ETAPFDSSLLRGSKFVFETGQGTVVEGLEVAVRSMRPYEQAEFIISYKLLFGE 169
            |||  ::.|   :...||:|..:|..:....|.|.:::|::..:..|.|.|:.:.||...|.:||
Human   177 VRY--HYNGTLLDGTSFDTSYSKGGTYDTYVGSGWLIKGMDQGLLGMCPGERRKIIIPPFLAYGE 239

  Fly   170 LGCPPRIKPKADALFKVEVIDYSLIGDAKGIDAI 203
            .|....|.|:|..:|.|.:||.....||..::.:
Human   240 KGYGTVIPPQASLVFHVLLIDVHNPKDAVQLETL 273

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
shu	NP_611837.1	FKBP_C	96..189	CDD:278674	25/83 (30%)
		TPR repeat	218..257	CDD:276809
		TPR repeat	262..295	CDD:276809
		TPR repeat	304..329	CDD:276809
FKBP10	XP_011523401.1	FKBP_C	55..147	CDD:278674
		FKBP_C	167..259	CDD:278674	25/83 (30%)
		FKBP_C	279..371	CDD:278674
		FKBP_C	392..502	CDD:278674
		EF-hand_7	523..587	CDD:290234
		EFh	525..586	CDD:238008
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0545
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.810