DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment shu and FKBP7

DIOPT Version :9

Sequence 1:	NP_611837.1	Gene:	shu / 45360	FlyBaseID:	FBgn0003401	Length:	455	Species:	Drosophila melanogaster
Sequence 2:	NP_851939.1	Gene:	FKBP7 / 51661	HGNCID:	3723	Length:	222	Species:	Homo sapiens

Alignment Length:	131	Identity:	32/131 - (24%)
Similarity:	58/131 - (44%)	Gaps:	25/131 - (19%)

- Green bases have known domain annotations that are detailed below.

  Fly   106 VSVRYSGYWEGETAPFDSSLLRGSKFV------------FETGQGTVVEGLEVAVRSMRPYEQAE 158
            ::..|.||...:          ||||.            |..|.|.|::||::|:..|.|.|:.:
Human    56 LNAHYDGYLAKD----------GSKFYCSRTQNEGHPKWFVLGVGQVIKGLDIAMTDMCPGEKRK 110

  Fly   159 FIISYKLLFGELG-CPPRIKPKADALFKVEVIDYSLIGDAKGIDAIPQEDRDKFCVVYPKAVDLH 222
            .:|.....:|:.| ...:|.|.|..:|::|:  |::....:.|:...|.|.|....:....::|:
Human   111 VVIPPSFAYGKEGYAEGKIPPDATLIFEIEL--YAVTKGPRSIETFKQIDMDNDRQLSKAEINLY 173

  Fly   223 L 223
            |
Human   174 L 174

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
shu	NP_611837.1	FKBP_C	96..189	CDD:278674	25/95 (26%)
		TPR repeat	218..257	CDD:276809	2/6 (33%)
		TPR repeat	262..295	CDD:276809
		TPR repeat	304..329	CDD:276809
FKBP7	NP_851939.1	FKBP_C	46..141	CDD:306713	24/94 (26%)
		EF-hand_7	152..214	CDD:316058	5/23 (22%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	200..222
		Retention in the endoplasmic reticulum. /evidence=ECO:0000255\|PROSITE-ProRule:PRU10138	219..222
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0545
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900