DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shu and fkbp2

DIOPT Version :9

Sequence 1:NP_611837.1 Gene:shu / 45360 FlyBaseID:FBgn0003401 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_001004677.2 Gene:fkbp2 / 447939 ZFINID:ZDB-GENE-040912-126 Length:138 Species:Danio rerio


Alignment Length:110 Identity:34/110 - (30%)
Similarity:58/110 - (52%) Gaps:13/110 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 IYKRITRTGHVDREAVPNKAR----VSVRYSGYWEGETAPFDSSLLRGSKFVFETGQGTVVEGLE 145
            |.||:        :..|.|:|    :::.|:|..|..| .||||:.|...|.|..|.|.|::|.:
Zfish    31 IKKRV--------DNCPIKSRKGDVLNMHYTGKLEDGT-EFDSSIPRNQPFTFTLGTGQVIKGWD 86

  Fly   146 VAVRSMRPYEQAEFIISYKLLFGELGCPPRIKPKADALFKVEVID 190
            ..:..|...|:.:.:|..:|.:|:.|.||:|...|..:|:||:::
Zfish    87 QGLLGMCEGEKRKLVIPSELGYGDRGAPPKIPGGATLIFEVELLN 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shuNP_611837.1 FKBP_C 96..189 CDD:278674 31/96 (32%)
TPR repeat 218..257 CDD:276809
TPR repeat 262..295 CDD:276809
TPR repeat 304..329 CDD:276809
fkbp2NP_001004677.2 FKBP_C 38..130 CDD:278674 31/92 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.