DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shu and Spag1

DIOPT Version :9

Sequence 1:NP_611837.1 Gene:shu / 45360 FlyBaseID:FBgn0003401 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_651514.1 Gene:Spag1 / 43239 FlyBaseID:FBgn0039463 Length:469 Species:Drosophila melanogaster


Alignment Length:470 Identity:85/470 - (18%)
Similarity:160/470 - (34%) Gaps:141/470 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PLSYSDL-----------VKKGVEFEVDNSQQNHARDL---------GLDSDS-----DSDYEDA 55
            |:.|.|.           ::|.|:. :.:.::.|..||         .|..||     :...:.:
  Fly    16 PIHYLDFAHVEKCTNAREMEKIVQI-LRSGEEGHYPDLQRCAEEKLKALKPDSKLFRYEEQIKQS 79

  Fly    56 LDVDGEELRS--PWT-------YSFDELRAL-----------MSEIDENIYKRITRTGHVDREAV 100
            .|:|..||:.  .||       .:.:||:.:           :|:||.....:..:.....:...
  Fly    80 TDLDKTELKPILDWTDAIKTKDNALNELKKVKQNLNLPSVRKLSKIDLEKESKTEKPKPAPKATS 144

  Fly   101 PNKAR---VSVRYSGYWEGETAPFDSSLLRGSKFVFETGQGTVVEGLEVAVRSMRPYEQAEFIIS 162
            |:..:   ..::.:.|.:.:....|..:||                  :.:...|..||.|.|||
  Fly   145 PSNTKNKEARIKSTDYRKWDKYDPDEEILR------------------MDLNEERDQEQREKIIS 191

  Fly   163 YKLLFGELGCPPRIKPKADALFKVEVIDYSLIGDAKGIDAIPQEDRDKFCVVYPKAVDLH-LHGK 226
            .   ..:.....:::.:.|:|::      .|....|.:.   |.::::|       .:.| |.|.
  Fly   192 N---HSKSVTTDKLQSERDSLYE------RLQAQLKNLS---QLEKEQF-------AERHRLRGN 237

  Fly   227 DSVKLGRYQSAATAFERAVSSLNYCRMANDEEERKQTELLTTLNQNLMIVYNKMNK------PKR 285
            :|.|       |..:|.|:...| |.:..|.|.....      ..|..:.:.|:.|      ..:
  Fly   238 ESFK-------AKEYENAIEEYN-CSIIYDPENAVHA------YNNRAVAHLKLKKYFSAISDCQ 288

  Fly   286 ACIM---MKALRHLTMGNPSCKALFQEGRALAALGEYN----------LARNA------YLQAQA 331
            ||:.   |....||.|    .:|...||:.|.:|..|.          :|:.|      .|...|
  Fly   289 ACLQIDPMNIKAHLRM----AEAHNAEGKHLESLNVYKKLLDFEPDNAIAKKAVEKLTSMLGEVA 349

  Fly   332 KQPANKEISDEIISMNKRISKYEEASRDIWARAFSLKNSKSDVRKTPAQLEKEAKEQDFND-KME 395
            ...|.:.|.:||.....:.|:.::.:          :.|:..|.|.|..:....|.....| .:.
  Fly   350 PSSATRLIIEEIDPPQLKTSEPKKEA----------EKSEPTVVKKPEPVVSAKKPPPIKDYDLA 404

  Fly   396 DLIRRFKNTSDQQVS 410
            :|::..:......||
  Fly   405 ELVKPNRMVKSNLVS 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shuNP_611837.1 FKBP_C 96..189 CDD:278674 14/95 (15%)
TPR repeat 218..257 CDD:276809 10/39 (26%)
TPR repeat 262..295 CDD:276809 6/41 (15%)
TPR repeat 304..329 CDD:276809 9/40 (23%)
Spag1NP_651514.1 TPR_11 229..295 CDD:290150 17/79 (22%)
TPR repeat 229..257 CDD:276809 10/35 (29%)
TPR repeat 262..293 CDD:276809 5/36 (14%)
TPR_11 266..329 CDD:290150 15/72 (21%)
TPR 266..297 CDD:197478 5/36 (14%)
TPR repeat 298..326 CDD:276809 9/31 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.