DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shu and CG14715

DIOPT Version :9

Sequence 1:NP_611837.1 Gene:shu / 45360 FlyBaseID:FBgn0003401 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_650101.1 Gene:CG14715 / 41403 FlyBaseID:FBgn0037930 Length:138 Species:Drosophila melanogaster


Alignment Length:110 Identity:34/110 - (30%)
Similarity:49/110 - (44%) Gaps:14/110 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 IYKRITRTGHVDREAVPNKAR----VSVRYSGYWEGETAPFDSSLLRGSKFVFETGQGTVVEGLE 145
            |.||:        |....||:    |.|.|.|..:..| .||||..||:.|.|..|...|::|.:
  Fly    27 IKKRV--------ENCTRKAKGGDLVHVHYRGALQDGT-EFDSSYSRGTPFSFTLGARQVIKGWD 82

  Fly   146 VAVRSMRPYEQAEFIISYKLLFGELGC-PPRIKPKADALFKVEVI 189
            ..:..|...||.:..|..:|.:|..|. ..:|.|.|..:|..|::
  Fly    83 QGILGMCEGEQRKLTIPPELGYGASGAGGGKIPPNAVLVFDTELV 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shuNP_611837.1 FKBP_C 96..189 CDD:278674 31/97 (32%)
TPR repeat 218..257 CDD:276809
TPR repeat 262..295 CDD:276809
TPR repeat 304..329 CDD:276809
CG14715NP_650101.1 FKBP_C 34..127 CDD:278674 30/93 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452522
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.