DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shu and zc3h7a

DIOPT Version :9

Sequence 1:NP_611837.1 Gene:shu / 45360 FlyBaseID:FBgn0003401 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_998599.1 Gene:zc3h7a / 406743 ZFINID:ZDB-GENE-040426-2776 Length:983 Species:Danio rerio


Alignment Length:155 Identity:32/155 - (20%)
Similarity:57/155 - (36%) Gaps:20/155 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 GKDSVKLGRYQSAATAFERAVSSLNYCRMANDEEERKQTELLTTLNQNLMIVYNKMNKPKRACIM 289
            |.|....|.:..|...:..|   ||....|:.|:.....:|...|:.|....|..:....:|  :
Zfish    50 GNDVFHEGEWARAVNLYTEA---LNISEYADSEDILIAQDLNEKLHANRAASYLNIELHDQA--L 109

  Fly   290 MKALRHLTMGNPSCKALFQEGRALAALGEYNLARNAYLQAQAKQPANKEISDEIISMNKRISKYE 354
            ....:.|.:...:.:||:::.|.|..:|....|..|..:.....|.:    ..:|.:.:.:    
Zfish   110 EDCEKALQLNESNYRALYRKARCLKEIGRLQEAYEAVAKCSMAVPQD----TRVIELTQEL---- 166

  Fly   355 EASRDIWARAFSLKNSKSDVRKTPA 379
                   |:...||..|:.||..||
Zfish   167 -------AKMLGLKIRKAYVRSKPA 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shuNP_611837.1 FKBP_C 96..189 CDD:278674
TPR repeat 218..257 CDD:276809 8/31 (26%)
TPR repeat 262..295 CDD:276809 5/32 (16%)
TPR repeat 304..329 CDD:276809 7/24 (29%)
zc3h7aNP_998599.1 TPR_11 44..120 CDD:290150 15/74 (20%)
TPR repeat 46..71 CDD:276809 5/23 (22%)
TPR repeat 88..118 CDD:276809 5/31 (16%)
TPR_1 90..122 CDD:278916 5/33 (15%)
TPR_19 105..166 CDD:291240 11/66 (17%)
TPR_17 112..142 CDD:290167 6/29 (21%)
TPR repeat 123..149 CDD:276809 7/25 (28%)
zf-C2H2_jaz 871..894 CDD:288983
C2H2 Zn finger 871..893 CDD:275371
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.