DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shu and fkbp1b

DIOPT Version :9

Sequence 1:NP_611837.1 Gene:shu / 45360 FlyBaseID:FBgn0003401 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_957106.1 Gene:fkbp1b / 393785 ZFINID:ZDB-GENE-040426-1785 Length:108 Species:Danio rerio


Alignment Length:95 Identity:29/95 - (30%)
Similarity:44/95 - (46%) Gaps:2/95 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 DREAVPNKARVS-VRYSGYWEGETAPFDSSLLRGSKFVFETGQGTVVEGLEVAVRSMRPYEQAEF 159
            |....|.|.:.. |.|.|..: ....||||..|...|.|:.|:..|::|.|..|..|...::|:.
Zfish    12 DGRTFPKKGQTCVVHYIGMLQ-NGKKFDSSRDRNKPFKFKIGRQEVIKGWEEGVAQMSLGQRAKI 75

  Fly   160 IISYKLLFGELGCPPRIKPKADALFKVEVI 189
            ..:..:.:|..|.|..|.|.|..:|.||::
Zfish    76 TCTPDMAYGATGHPGVIPPNATLIFDVELL 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shuNP_611837.1 FKBP_C 96..189 CDD:278674 29/93 (31%)
TPR repeat 218..257 CDD:276809
TPR repeat 262..295 CDD:276809
TPR repeat 304..329 CDD:276809
fkbp1bNP_957106.1 FkpA <2..106 CDD:223619 29/95 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.