DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shu and Fkbp10

DIOPT Version :9

Sequence 1:NP_611837.1 Gene:shu / 45360 FlyBaseID:FBgn0003401 Length:455 Species:Drosophila melanogaster
Sequence 2:XP_038942330.1 Gene:Fkbp10 / 360627 RGDID:1549751 Length:620 Species:Rattus norvegicus


Alignment Length:161 Identity:43/161 - (26%)
Similarity:70/161 - (43%) Gaps:21/161 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 VPNKARVSVRYSGYWEGETAPFDSSLLRGSKFVFETGQGTVVEGLEVAVRSMRPYEQAEFIISYK 164
            |.|...|...|:|.....|| ||||..||..:....|.|.:::|::..:..|.|.|:.:.||...
  Rat   170 VRNSDFVRYHYNGTLLDGTA-FDSSYSRGGTYDTYIGSGWLIKGMDQGLLGMCPGEKRKIIIPPF 233

  Fly   165 LLFGELGC-----PPRIKPKADALFKVEVIDYSLIG-DAKGIDAIPQEDRDKFCVVYPKA----- 218
            |.:||.|.     .|::..:. .||.:..:....:| ...|...:|...    .|:.|:|     
  Rat   234 LAYGEKGYGSVWGQPKVGDRG-GLFGMRPLAVPGLGPQMYGSSPVPSPG----TVIPPQASLVFY 293

  Fly   219 ---VDLHLHGKDSVKLGRYQSAATAFERAVS 246
               :|:| :.||:|:|...:.......|||:
  Rat   294 VLLIDVH-NPKDTVQLETLELPQDCVRRAVA 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shuNP_611837.1 FKBP_C 96..189 CDD:278674 28/93 (30%)
TPR repeat 218..257 CDD:276809 10/37 (27%)
TPR repeat 262..295 CDD:276809
TPR repeat 304..329 CDD:276809
Fkbp10XP_038942330.1 FKBP_C 54..146 CDD:395196
FKBP_C 166..297 CDD:395196 34/132 (26%)
FKBP_C 317..409 CDD:395196 3/7 (43%)
FKBP_C 430..521 CDD:395196
EFh 544..605 CDD:238008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.