DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shu and Fkbp15

DIOPT Version :9

Sequence 1:NP_611837.1 Gene:shu / 45360 FlyBaseID:FBgn0003401 Length:455 Species:Drosophila melanogaster
Sequence 2:XP_006538097.1 Gene:Fkbp15 / 338355 MGIID:2444782 Length:1255 Species:Mus musculus


Alignment Length:257 Identity:56/257 - (21%)
Similarity:98/257 - (38%) Gaps:72/257 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 LHG-KDSVKLGRYQSAATAFERAVSSLNYCRMANDEEERKQTELLTTLNQNLMIVYNKMNKPKRA 286
            ||. ::..|:....:||||      .:::.::.....::|:|||...|..||          |..
Mouse   630 LHAEQEKAKVTEELAAATA------QVSHLQLKMTAHQKKETELQLQLTDNL----------KET 678

  Fly   287 CIMMKALRHLTMGNPSCKALFQEGRALAALGEYNLARNAYLQAQAKQPANKEISDEIISMNKRIS 351
            .::.   .|:|             |..|.|.|   .|.|..|.|.|..:.|:...:   :..:::
Mouse   679 DLLR---GHVT-------------RLQADLSE---LREASEQTQTKFKSEKQSRRQ---LELKVT 721

  Fly   352 KYEEASRDIWARAFSLKNSKSDVRKTPA----QLEKEAKE-----QDFNDKMEDLIRRFKNTSDQ 407
            ..||...|:.|...||:.:.|:.:|..|    |.|.|..|     |:..|::..|:::.:.::||
Mouse   722 SLEEELTDLRAEKTSLEKNLSERKKKSAQERCQAEAEMDEIRKSHQEELDRLRQLLKKARVSTDQ 786

  Fly   408 ----------------------QVSFSRKSYSNAQFDATCKLAKEHNLKLTLSPIQEDVLTL 447
                                  |:..|.:.....|:...|.....|..||.|  :|::.|.|
Mouse   787 AAAEQLTLAQAELQSQWEAKCEQLLASARDEHLQQYREVCAQRDAHQQKLAL--LQDECLAL 846

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shuNP_611837.1 FKBP_C 96..189 CDD:278674
TPR repeat 218..257 CDD:276809 7/34 (21%)
TPR repeat 262..295 CDD:276809 7/32 (22%)
TPR repeat 304..329 CDD:276809 6/24 (25%)
Fkbp15XP_006538097.1 FKBP_C 192..285 CDD:365980
PRK10263 <378..>489 CDD:236669
Smc <561..890 CDD:224117 56/257 (22%)
PHA03247 <944..1129 CDD:223021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.