DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shu and Fkbp14

DIOPT Version :9

Sequence 1:NP_611837.1 Gene:shu / 45360 FlyBaseID:FBgn0003401 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_705801.1 Gene:Fkbp14 / 231997 MGIID:2387639 Length:211 Species:Mus musculus


Alignment Length:85 Identity:20/85 - (23%)
Similarity:42/85 - (49%) Gaps:3/85 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 VRYSGYWEGETAPFDSSLL--RGSKFVFETGQGTVVEGLEVAVRSMRPYEQAEFIISYKLLFGEL 170
            |.|.||.|.:.:.|.|:..  .|....|..|...|::|.:..::.|...|:.:..:...|.:|:.
Mouse    50 VHYEGYLEKDGSLFHSTHKHNNGQPVWFTLGILEVLKGWDQGLKGMCVGEKRKLTVPPALGYGKE 114

  Fly   171 GCPPRIKPKADALFKVEVID 190
            | ..:|.|::..:|.:::::
Mouse   115 G-KGKIPPESTLIFNIDLLE 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shuNP_611837.1 FKBP_C 96..189 CDD:278674 20/82 (24%)
TPR repeat 218..257 CDD:276809
TPR repeat 262..295 CDD:276809
TPR repeat 304..329 CDD:276809
Fkbp14NP_705801.1 FKBP_C 38..132 CDD:278674 20/82 (24%)
EF-hand_7 141..204 CDD:290234
EFh 142..204 CDD:298682
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 208..211
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.