DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shu and FKBP1B

DIOPT Version :10

Sequence 1:NP_611837.1 Gene:shu / 45360 FlyBaseID:FBgn0003401 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_004107.1 Gene:FKBP1B / 2281 HGNCID:3712 Length:108 Species:Homo sapiens


Alignment Length:96 Identity:28/96 - (29%)
Similarity:44/96 - (45%) Gaps:2/96 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 DREAVPNKARVS-VRYSGYWEGETAPFDSSLLRGSKFVFETGQGTVVEGLEVAVRSMRPYEQAEF 159
            |....|.|.:.. |.|:|..: ....||||..|...|.|..|:..|::|.|.....|...::|:.
Human    12 DGRTFPKKGQTCVVHYTGMLQ-NGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQMSLGQRAKL 75

  Fly   160 IISYKLLFGELGCPPRIKPKADALFKVEVID 190
            ..:..:.:|..|.|..|.|.|..:|.||:::
Human    76 TCTPDVAYGATGHPGVIPPNATLIFDVELLN 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shuNP_611837.1 FKBP_C 96..189 CDD:459735 28/93 (30%)
TPR repeat 218..257 CDD:276809
TPR 230..>389 CDD:440225
TPR repeat 262..295 CDD:276809
TPR repeat 304..329 CDD:276809
FKBP1BNP_004107.1 FKBP_C 13..105 CDD:459735 27/92 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.