DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shu and fkb-6

DIOPT Version :9

Sequence 1:NP_611837.1 Gene:shu / 45360 FlyBaseID:FBgn0003401 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_508026.1 Gene:fkb-6 / 180371 WormBaseID:WBGene00001431 Length:431 Species:Caenorhabditis elegans


Alignment Length:386 Identity:79/386 - (20%)
Similarity:133/386 - (34%) Gaps:110/386 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 VSVRYSGYWEGETAPFDSSLLRGSKFVFETGQGTVVEGLEVAVRSMRPYEQAEFIISYKLLFGEL 170
            |.|.|.|..|..| .||||..||.:|.|..|:|.|::|.::.|.:|...|.|||.|.....:|:.
 Worm    36 VKVHYVGTLENGT-KFDSSRDRGDQFSFNLGRGNVIKGWDLGVATMTKGEVAEFTIRSDYGYGDA 99

  Fly   171 GCPPRIKPKADALFKVEVIDYS---LIGDAKGI---DAIPQEDRDKF----------CV------ 213
            |.||:|...|..:|:||:.::|   :..|..|.   ..|.:..::.|          ||      
 Worm   100 GSPPKIPGGATLIFEVELFEWSAEDISPDRDGTILRTIIVEGSKNSFPNDTSKVLAHCVGTYQGT 164

  Fly   214 -VYPKAVDLHL------------------------------------------------------ 223
             .|.:.|:.|:                                                      
 Worm   165 EFYNREVNFHIGEGSEEGLPEGVERALRRFQLGEKSKIEIRGHKYTYGNSPPAGSNIPVNATLEF 229

  Fly   224 --------------------------HGKDS----VKLGRYQSAATAFERAVSSLNYCRMANDEE 258
                                      ..||.    ::.|..:.|...::||...|.|.:..:.|:
 Worm   230 TIFLKEFEKVPATWEMTAEEKLDAAKQAKDRGTMYLQKGNLKLAYNKYKRAEEVLEYEKSTDPEK 294

  Fly   259 ERKQTELLTTLNQNLMIVYNKMNKPKRACIMMKALRHLTMGNPSCKALFQEGRALAALGEYNLAR 323
            ..::..:|.....||.:|.:|.|:..........:.....||  .|||:::..||..:.|...|.
 Worm   295 MAERETILNGAYLNLSLVCSKQNEQLECIKWCDKVLETKPGN--VKALYRKATALLTMNEVRDAM 357

  Fly   324 NAYLQAQAKQPANKEISDEIISMNKRISKYEEASRDIWARAFSLKNSKSDVRKTPAQLEKE 384
            ..:.:....:|.||..:.:||.....|.:..|..:..:...|:..:::.|......:.|.|
 Worm   358 KLFEKIVEVEPENKAAAQQIIVCRNTIREQNERDKKRFKNLFAKISTEEDKPTNTVEDEDE 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shuNP_611837.1 FKBP_C 96..189 CDD:278674 34/82 (41%)
TPR repeat 218..257 CDD:276809 10/122 (8%)
TPR repeat 262..295 CDD:276809 6/32 (19%)
TPR repeat 304..329 CDD:276809 7/24 (29%)
fkb-6NP_508026.1 FKBP_C 26..117 CDD:278674 33/81 (41%)
TPR_11 254..334 CDD:290150 15/79 (19%)
TPR repeat 254..282 CDD:276809 6/27 (22%)
TPR repeat 291..332 CDD:276809 7/40 (18%)
TPR_11 305..368 CDD:290150 14/64 (22%)
TPR_1 337..370 CDD:278916 8/32 (25%)
TPR repeat 337..365 CDD:276809 7/27 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.