DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shu and pph-5

DIOPT Version :9

Sequence 1:NP_611837.1 Gene:shu / 45360 FlyBaseID:FBgn0003401 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_001367002.1 Gene:pph-5 / 180263 WormBaseID:WBGene00012665 Length:496 Species:Caenorhabditis elegans


Alignment Length:284 Identity:56/284 - (19%)
Similarity:93/284 - (32%) Gaps:124/284 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 IKPKADALFKVEVIDYSLIGDAKGIDAIPQEDRDKFCVVYPKAVDLH----LHGKDS---VKLGR 233
            ||.:|:..||.:|  |.:..|                 :|..|:::|    |:|..:   :|...
 Worm    32 IKDEANQFFKDQV--YDVAAD-----------------LYSVAIEIHPTAVLYGNRAQAYLKKEL 77

  Fly   234 YQSAATAFERAVSSLNYCRMANDEEERKQTELLTTLNQNLMIVYNKMNKPKRACIMMKALRHLTM 298
            |.||....:.|::.                                                   
 Worm    78 YGSALEDADNAIAI--------------------------------------------------- 91

  Fly   299 GNPS-CKALFQEGRALAALGEYNLARNAYLQAQAKQ-PANKEISDEIISMNKRISKYEEASRDIW 361
             :|| .|..::...|..|||.:..|...| ||..|. |.:|:..          :|::|.|:.:.
 Worm    92 -DPSYVKGFYRRATANMALGRFKKALTDY-QAVVKVCPNDKDAR----------AKFDECSKIVR 144

  Fly   362 ARAFSLKNSKSDVRKTPAQ---LEKEAKEQDFN-DKMED---------LIRRFKNTSDQQVSFSR 413
            .:.|....|....:||.|:   :...|.|..:: .::||         ||:.|||   ||     
 Worm   145 RQKFEAAISTDHDKKTVAETLDINAMAIEDSYDGPRLEDKITKEFVLQLIKTFKN---QQ----- 201

  Fly   414 KSYSNAQFDATCKLAKEHNLKLTL 437
                        ||.|::..|:.|
 Worm   202 ------------KLHKKYAFKMLL 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shuNP_611837.1 FKBP_C 96..189 CDD:278674 5/12 (42%)
TPR repeat 218..257 CDD:276809 9/45 (20%)
TPR repeat 262..295 CDD:276809 0/32 (0%)
TPR repeat 304..329 CDD:276809 7/24 (29%)
pph-5NP_001367002.1 PLN03088 29..>139 CDD:215568 33/188 (18%)
TPR repeat 33..57 CDD:276809 9/42 (21%)
TPR repeat 62..91 CDD:276809 7/28 (25%)
TPR repeat 96..124 CDD:276809 9/28 (32%)
MPP_PP5_C 176..490 CDD:277362 14/58 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.