powered by:
Protein Alignment shu and fkb-4
DIOPT Version :9
Sequence 1: | NP_611837.1 |
Gene: | shu / 45360 |
FlyBaseID: | FBgn0003401 |
Length: | 455 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_506197.1 |
Gene: | fkb-4 / 179752 |
WormBaseID: | WBGene00001429 |
Length: | 259 |
Species: | Caenorhabditis elegans |
Alignment Length: | 65 |
Identity: | 20/65 - (30%) |
Similarity: | 33/65 - (50%) |
Gaps: | 0/65 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 122 DSSLLRGSKFVFETGQGTVVEGLEVAVRSMRPYEQAEFIISYKLLFGELGCPPRIKPKADALFKV 186
|||..|.:.|||......|::|:::|:..|...|:...:|..:..:|..|.||.|...|...|::
Worm 184 DSSYSRNAPFVFRLRNREVIDGMDIAMDGMCEGERRRVVIPSEYGYGSQGSPPEIPGGARLFFEI 248
Fly 187 186
Worm 249 248
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C160160760 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0545 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.740 |
|
Return to query results.
Submit another query.