powered by:
Protein Alignment shu and fkb-2
DIOPT Version :9
Sequence 1: | NP_611837.1 |
Gene: | shu / 45360 |
FlyBaseID: | FBgn0003401 |
Length: | 455 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001021722.1 |
Gene: | fkb-2 / 173160 |
WormBaseID: | WBGene00001427 |
Length: | 108 |
Species: | Caenorhabditis elegans |
Alignment Length: | 68 |
Identity: | 26/68 - (38%) |
Similarity: | 41/68 - (60%) |
Gaps: | 0/68 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 122 DSSLLRGSKFVFETGQGTVVEGLEVAVRSMRPYEQAEFIISYKLLFGELGCPPRIKPKADALFKV 186
|||..||:.|.|:.|:|.|::|.:..|..|...|:::..||..|.:|..|.||:|...|..:|:|
Worm 38 DSSRDRGTPFKFKIGKGEVIKGWDQGVAQMSVGEKSKLTISADLGYGPRGVPPQIPANATLVFEV 102
Fly 187 EVI 189
|::
Worm 103 ELL 105
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0545 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.