powered by:
Protein Alignment shu and fkb-8
DIOPT Version :9
Sequence 1: | NP_611837.1 |
Gene: | shu / 45360 |
FlyBaseID: | FBgn0003401 |
Length: | 455 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001021725.1 |
Gene: | fkb-8 / 173159 |
WormBaseID: | WBGene00001433 |
Length: | 290 |
Species: | Caenorhabditis elegans |
Alignment Length: | 71 |
Identity: | 23/71 - (32%) |
Similarity: | 35/71 - (49%) |
Gaps: | 1/71 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 132 VFETGQGTVVEGLEVAVRSMRPYEQAEFIISYKLLFGELGCPPRIKPKADALFKVEVIDYSLIGD 196
:|:.|.|.|:.||::.:..|:..|.|.|.:|.|..:|..|....|...|....||.:.:.|....
Worm 130 IFKIGFGEVIPGLDIGIPKMKVGEIATFHVSGKYGYGRAGFRGLIPRNASLTCKVRLFNCSWDSY 194
Fly 197 AK-GID 201
|| |:|
Worm 195 AKIGVD 200
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0545 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.