DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shu and Fkbp7

DIOPT Version :9

Sequence 1:NP_611837.1 Gene:shu / 45360 FlyBaseID:FBgn0003401 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_034352.1 Gene:Fkbp7 / 14231 MGIID:1336879 Length:218 Species:Mus musculus


Alignment Length:199 Identity:47/199 - (23%)
Similarity:77/199 - (38%) Gaps:53/199 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 DSDSDSDYEDALDVDGEELRSPWTYSFDELRALMSEIDENIYKRITRTGHVDREAVPNKARVSVR 109
            |:...:..|...:|..|.|..|                ||..| .:|.|.:          ::..
Mouse    18 DAQGQTKEESTEEVKIEVLHRP----------------ENCSK-TSRKGDL----------LNAH 55

  Fly   110 YSGYWEGETAPFDSSLLRGSKFV------------FETGQGTVVEGLEVAVRSMRPYEQAEFIIS 162
            |.||...:          ||||.            |..|.|.|::||::|:..|.|.|:.:.||.
Mouse    56 YDGYLAKD----------GSKFYCSRTQDEGHPKWFVLGVGHVIKGLDIAMMDMCPGEKRKVIIP 110

  Fly   163 YKLLFGELG-CPPRIKPKADALFKVEVIDYSLIGDAKGIDAIPQEDRDKFCVVYPKAVDLHLHGK 226
            ....:|:.| ...:|.|.|..:|::|:  |::....:.|:...|.|.|....:....::|:|. |
Mouse   111 PSFAYGKEGYAEGKIPPNATLMFEIEL--YAVTKGPRSIETFKQIDTDNDRQLSKAEIELYLQ-K 172

  Fly   227 DSVK 230
            |..|
Mouse   173 DFEK 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shuNP_611837.1 FKBP_C 96..189 CDD:278674 26/105 (25%)
TPR repeat 218..257 CDD:276809 5/13 (38%)
TPR repeat 262..295 CDD:276809
TPR repeat 304..329 CDD:276809
Fkbp7NP_034352.1 FKBP_C 42..137 CDD:278674 28/115 (24%)
EF-hand_7 148..210 CDD:290234 8/30 (27%)
EFh 148..209 CDD:298682 8/30 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 197..218
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 215..218
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.