Sequence 1: | NP_611837.1 | Gene: | shu / 45360 | FlyBaseID: | FBgn0003401 | Length: | 455 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_034352.1 | Gene: | Fkbp7 / 14231 | MGIID: | 1336879 | Length: | 218 | Species: | Mus musculus |
Alignment Length: | 199 | Identity: | 47/199 - (23%) |
---|---|---|---|
Similarity: | 77/199 - (38%) | Gaps: | 53/199 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 45 DSDSDSDYEDALDVDGEELRSPWTYSFDELRALMSEIDENIYKRITRTGHVDREAVPNKARVSVR 109
Fly 110 YSGYWEGETAPFDSSLLRGSKFV------------FETGQGTVVEGLEVAVRSMRPYEQAEFIIS 162
Fly 163 YKLLFGELG-CPPRIKPKADALFKVEVIDYSLIGDAKGIDAIPQEDRDKFCVVYPKAVDLHLHGK 226
Fly 227 DSVK 230 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
shu | NP_611837.1 | FKBP_C | 96..189 | CDD:278674 | 26/105 (25%) |
TPR repeat | 218..257 | CDD:276809 | 5/13 (38%) | ||
TPR repeat | 262..295 | CDD:276809 | |||
TPR repeat | 304..329 | CDD:276809 | |||
Fkbp7 | NP_034352.1 | FKBP_C | 42..137 | CDD:278674 | 28/115 (24%) |
EF-hand_7 | 148..210 | CDD:290234 | 8/30 (27%) | ||
EFh | 148..209 | CDD:298682 | 8/30 (27%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 197..218 | ||||
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 | 215..218 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0545 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |