DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shu and Fkbp12

DIOPT Version :10

Sequence 1:NP_611837.1 Gene:shu / 45360 FlyBaseID:FBgn0003401 Length:455 Species:Drosophila melanogaster
Sequence 2:XP_061517035.1 Gene:Fkbp12 / 1280504 VectorBaseID:AGAMI1_011056 Length:108 Species:Anopheles gambiae


Alignment Length:95 Identity:31/95 - (32%)
Similarity:46/95 - (48%) Gaps:2/95 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 DREAVPNKARVS-VRYSGYWEGETAPFDSSLLRGSKFVFETGQGTVVEGLEVAVRSMRPYEQAEF 159
            |:...|...:.: |.|:|..:..|. ||||..||..|.|..|:|.|:.|.:..|..|...::|:.
Mosquito    12 DQTTFPKPGQTAVVHYTGTLDDGTV-FDSSRTRGKPFKFSVGKGEVIRGWDEGVAQMSVGQRAKL 75

  Fly   160 IISYKLLFGELGCPPRIKPKADALFKVEVI 189
            :.|....:|..|.|..|.|.|...|.||::
Mosquito    76 VCSPDYAYGSRGHPGVIPPNARLTFDVELL 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shuNP_611837.1 FKBP_C 96..189 CDD:459735 31/93 (33%)
TPR repeat 218..257 CDD:276809
TPR 230..>389 CDD:440225
TPR repeat 262..295 CDD:276809
TPR repeat 304..329 CDD:276809
Fkbp12XP_061517035.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.