| Sequence 1: | NP_611837.1 | Gene: | shu / 45360 | FlyBaseID: | FBgn0003401 | Length: | 455 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_312821.4 | Gene: | AgaP_AGAP003134 / 1273806 | VectorBaseID: | AGAP003134 | Length: | 137 | Species: | Anopheles gambiae |
| Alignment Length: | 84 | Identity: | 28/84 - (33%) |
|---|---|---|---|
| Similarity: | 47/84 - (55%) | Gaps: | 1/84 - (1%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 106 VSVRYSGYWEGETAPFDSSLLRGSKFVFETGQGTVVEGLEVAVRSMRPYEQAEFIISYKLLFGEL 170
Fly 171 GCPPRIKPKADALFKVEVI 189 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| shu | NP_611837.1 | FKBP_C | 96..189 | CDD:278674 | 28/82 (34%) |
| TPR repeat | 218..257 | CDD:276809 | |||
| TPR repeat | 262..295 | CDD:276809 | |||
| TPR repeat | 304..329 | CDD:276809 | |||
| AgaP_AGAP003134 | XP_312821.4 | FKBP_C | 37..129 | CDD:278674 | 28/82 (34%) |
| FkpA | <42..131 | CDD:223619 | 28/84 (33%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG0545 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||