DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pk and FHL5

DIOPT Version :9

Sequence 1:NP_724538.1 Gene:pk / 45343 FlyBaseID:FBgn0003090 Length:1299 Species:Drosophila melanogaster
Sequence 2:NP_001164278.1 Gene:FHL5 / 9457 HGNCID:17371 Length:284 Species:Homo sapiens


Alignment Length:254 Identity:66/254 - (25%)
Similarity:100/254 - (39%) Gaps:49/254 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   567 QYRVRQLLHQLPPHDNEVRYCHSLTDEERKELRLFSTQRKRDALGRGNVRQLMSARPCDGCDDLI 631
            ||....||.:.....::..||.:..|      |:||..                   |:.|...|
Human     9 QYCTASLLGKKYVLKDDSPYCVTCYD
------RVFSNY-------------------CEECKKPI 48

  Fly   632 STG--DIAVFATRLGPNASWHPACFACSVCRELLVDLIYFHRDGRMYCGRHHAETLKPRCSACDE 694
            .:.  |:..      .:..||..||.|:.|...||:..:..:|.|:.|...::.....:|..|..
Human    49 ESDSKDLCY------KDRHWHEGCFKCTKCNHSLVEKPFAAKDERLLCTECYS
NECSSKCFHCKR 107

  Fly   695 IIL-ADECTEAEGRAWHMNHFACHECDKQLGGQRYIMREGKPYCLHCFDAMFAEYCDYCGEAIGV 758
            .|: .....|.:|..||...|.|..|.:.:|.:..|.:|...||:.||:..||.||::|.:.|  
Human   108 TIMPGSRKMEFKGNYWHETCFVCENCRQPIGTKPLISKESGNYCVPCF
EKEFAHYCNFCKKVI-- 170

  Fly   759 DQGQMSHDGQHWHATDECFSCNTCRCSLLGRAFLPRRGAIYC-----------SIACSK 806
            ..|.::...|.||  .|||.|:.||..|....|:.|....:|           .:||||
Human   171 TSGGITFCDQLWH--KECFLCSGCRKDLCEEQFMSRDDYPFCVDCYNHLYANKCVACSK 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pkNP_724538.1 PET_Prickle 523..618 CDD:193602 10/50 (20%)
LIM1_Prickle 624..682 CDD:188799 15/59 (25%)
LIM2_Prickle 687..742 CDD:188802 16/55 (29%)
LIM3_Prickle 747..805 CDD:188804 19/68 (28%)
FHL5NP_001164278.1 LIM <5..34 CDD:351770 6/24 (25%)
LIM1_FHL 37..95 CDD:188729 17/82 (21%)
LIM2_FHL5 102..155 CDD:188812 15/52 (29%)
LIM3_FHL 163..214 CDD:188732 17/54 (31%)
LIM4_FHL 222..277 CDD:188733 4/6 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.