DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pk and LPXN

DIOPT Version :9

Sequence 1:NP_724538.1 Gene:pk / 45343 FlyBaseID:FBgn0003090 Length:1299 Species:Drosophila melanogaster
Sequence 2:NP_001137467.1 Gene:LPXN / 9404 HGNCID:14061 Length:391 Species:Homo sapiens


Alignment Length:183 Identity:57/183 - (31%)
Similarity:78/183 - (42%) Gaps:18/183 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   648 SWHPACFACSVCRELLVDLIYFHRDGRMYCGRHHAETLKPRCSACDEIILADECTEAEGRAWHMN 712
            ||||..|.|:.|:|.:....:|.|.|..||...:.:...|||:.|...|| |:...|..:.||..
Human   175 SWHPEHFVCTHCKEEIGSSPFFERSGLAYCPNDYH
QLFSPRCAYCAAPIL-DKVLTAMNQTWHPE 238

  Fly   713 HFACHECDKQLGGQRYIMREGKPYCLHCFDAMFAEYCDYCGEAIGVDQGQMSHDGQHWHATDECF 777
            ||.|..|.:..|.:.:..::.||||...|.|||:..|..|...  |.:..:|.....||  .|||
Human   239 HFFCSHCGEVFGAEGFHEKDKKPYCRKDF
LAMFSPKCGGCNRP--VLENYLSAMDTVWH--PECF 299

  Fly   778 SCNTCRCSLLGRAFLPRRGAIYCSI-----------ACSKGEPPTPSDSSGTG 819
            .|..|..|....:|....|..:|.:           .|  |:|.|....|..|
Human   300 VCGDCFTSFSTGSFFELDGRPFCELHYHHRRGTLCHGC--GQPITGRCISAMG 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pkNP_724538.1 PET_Prickle 523..618 CDD:193602
LIM1_Prickle 624..682 CDD:188799 13/33 (39%)
LIM2_Prickle 687..742 CDD:188802 19/54 (35%)
LIM3_Prickle 747..805 CDD:188804 15/68 (22%)
LPXNNP_001137467.1 LIM1_Leupaxin 155..209 CDD:188790 13/33 (39%)
LIM2_Leupaxin 216..267 CDD:188792 17/51 (33%)
LIM3_Leupaxin 275..327 CDD:188794 15/55 (27%)
LIM4_Paxillin_like 334..385 CDD:188725 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.