DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pk and LRG1

DIOPT Version :9

Sequence 1:NP_724538.1 Gene:pk / 45343 FlyBaseID:FBgn0003090 Length:1299 Species:Drosophila melanogaster
Sequence 2:NP_010041.2 Gene:LRG1 / 851358 SGDID:S000002399 Length:1017 Species:Saccharomyces cerevisiae


Alignment Length:218 Identity:46/218 - (21%)
Similarity:71/218 - (32%) Gaps:58/218 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   616 RQLMSARP-----------CDGCDDLISTGDIAVFATRLGPNASWHPACFACSVCRE-------- 661
            |.|.:|.|           |..|:.|:.........|.......:|.:||.|..|::        
Yeast     9 RSLNTASPMTVQVKNQKKICARCNKLVIPDSQRTKTTLKALGKYYHESCFTCQDCQKPLKPKYFP 73

  Fly   662 ----------LLVDLIYFHRDGRMYCGRHHAETLKPRCSACDEIILADECTEAEGRAWHMNHFAC 716
                      ||....||.|...:             |..||..:.....| |.|..:...||:|
Yeast    74 YQVDKTSESILLCQYDYFRRHNLL-------------CHVCDTPLRGLYYT-AFGYRYDEEHFSC 124

  Fly   717 HECDKQLGGQRYIMREGKPYCLHCFDAMFAEYCDYC-----GEAIGVDQGQMSHDGQHWHATDEC 776
            ..|....|.::..|...:.||.:.|...|::.|..|     .:.|...:|:..|   .||  .||
Yeast   125 TICATPCGVKKCFMYGNQLYCKYHFLKYFSKRCKGCEFPISDQYIEFPKGEEIH---CWH--PEC 184

  Fly   777 FSCN-----TCRCSLLGRAFLPR 794
            :..:     ......:|..:||:
Yeast   185 YGIHKYWHVNLAAETVGLQYLPK 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pkNP_724538.1 PET_Prickle 523..618 CDD:193602 1/1 (100%)
LIM1_Prickle 624..682 CDD:188799 14/75 (19%)
LIM2_Prickle 687..742 CDD:188802 14/54 (26%)
LIM3_Prickle 747..805 CDD:188804 12/58 (21%)
LRG1NP_010041.2 LIM1_Lrg1p_like 28..90 CDD:188777 11/61 (18%)
LIM 98..149 CDD:259829 14/51 (27%)
LIM3_Lrg1p_like 419..475 CDD:188779
RhoGAP_fLRG1 728..959 CDD:239862
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.