DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pk and WLIM1

DIOPT Version :9

Sequence 1:NP_724538.1 Gene:pk / 45343 FlyBaseID:FBgn0003090 Length:1299 Species:Drosophila melanogaster
Sequence 2:NP_172491.1 Gene:WLIM1 / 837558 AraportID:AT1G10200 Length:190 Species:Arabidopsis thaliana


Alignment Length:160 Identity:34/160 - (21%)
Similarity:48/160 - (30%) Gaps:45/160 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   620 SARPCDGCDDLISTGDIAVFATRLGPNASWHPACFACSVCRELLVDLIYFHRDGRMYCGRHHAET 684
            :.:.|..||..:...|     .....|..:|.|||.|..|:..|....|...:|.:||..|..:.
plant     6 TTQKCMACDKTVYLVD-----KLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRPHFDQN 65

  Fly   685 LK----------------------------------------PRCSACDEIILADECTEAEGRAW 709
            .|                                        .:|..||:.:...|.....|..:
plant    66 FKRTGSLEKSFEGTPKIGKPDRPLEGERPAGTKVSNMFGGTREKCVGCDKTVYPIEKVSVNGTLY 130

  Fly   710 HMNHFACHECDKQLGGQRYIMREGKPYCLH 739
            |.:.|.|......:....||..|||.||.|
plant   131 HKSCFKCTHGGCTISPSNYIAHEGKLYCKH 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pkNP_724538.1 PET_Prickle 523..618 CDD:193602
LIM1_Prickle 624..682 CDD:188799 17/57 (30%)
LIM2_Prickle 687..742 CDD:188802 16/53 (30%)
LIM3_Prickle 747..805 CDD:188804
WLIM1NP_172491.1 LIM1_SF3 6..68 CDD:188824 17/66 (26%)
LIM2_SF3 110..170 CDD:188825 16/51 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.