Sequence 1: | NP_724538.1 | Gene: | pk / 45343 | FlyBaseID: | FBgn0003090 | Length: | 1299 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_180413.2 | Gene: | AT2G28460 / 817394 | AraportID: | AT2G28460 | Length: | 720 | Species: | Arabidopsis thaliana |
Alignment Length: | 272 | Identity: | 56/272 - (20%) |
---|---|---|---|
Similarity: | 85/272 - (31%) | Gaps: | 92/272 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 623 PCD-----GCDDLISTGDIAVFATRLGPNASWHPACFACSVCRELLVDLIYFHRDGRMYC--GRH 680
Fly 681 HA--------------------------ETLKPRCSACDEIIL------------------ADEC 701
Fly 702 TEAEG---RAWHMNHFACHECDKQLGGQ-----RYIMREGKPYCLHC---FDAMFAEYCDYCGEA 755
Fly 756 IGVDQGQMSHDGQHWHATDECFSCNTCRCSLLGRAFLPRRGAIYCSIACSKGEPPTPSDSSGTGM 820
Fly 821 YTTPTPPTQRVR 832 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
pk | NP_724538.1 | PET_Prickle | 523..618 | CDD:193602 | |
LIM1_Prickle | 624..682 | CDD:188799 | 17/64 (27%) | ||
LIM2_Prickle | 687..742 | CDD:188802 | 18/83 (22%) | ||
LIM3_Prickle | 747..805 | CDD:188804 | 9/57 (16%) | ||
AT2G28460 | NP_180413.2 | C1_3 | 243..271 | CDD:284959 | |
C1_3 | 298..327 | CDD:284959 | 3/9 (33%) | ||
C1_2 | 353..384 | CDD:281148 | 11/35 (31%) | ||
C1_3 | 442..471 | CDD:284959 | 8/28 (29%) | ||
C1_2 | 610..639 | CDD:281148 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1593918at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |