DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pk and AT2G28460

DIOPT Version :9

Sequence 1:NP_724538.1 Gene:pk / 45343 FlyBaseID:FBgn0003090 Length:1299 Species:Drosophila melanogaster
Sequence 2:NP_180413.2 Gene:AT2G28460 / 817394 AraportID:AT2G28460 Length:720 Species:Arabidopsis thaliana


Alignment Length:272 Identity:56/272 - (20%)
Similarity:85/272 - (31%) Gaps:92/272 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   623 PCD-----GCDDLISTGDIAVFATRLGPNASWHPACFACSVCRELLVDLIYFHRDGRMYC--GRH 680
            |||     .|..|.....|:....|:....|:....::|||||: .:|..|    |...|  |..
plant   317 PCDFVIHKSCISLPRLIRISRHFHRIAYTPSFDEGDWSCSVCRK-KIDNDY----GGYVCTKGCS 376

  Fly   681 HA--------------------------ETLKPRCSACDEIIL------------------ADEC 701
            :|                          |.|.|.....|.||.                  .||.
plant   377 YAAHSKCATQSNVWDGIELEGEPEDIEEEVLPPFLEISDGIIQHFSHQQHHMKLDENTGRDYDEN 441

  Fly   702 TEAEG---RAWHMNHFACHECDKQLGGQ-----RYIMREGKPYCLHC---FDAMFAEYCDYCGEA 755
            .|.|.   ..:..|.::|.|||..|..:     |.|.....|:.|:.   ||.:...|.|.|...
plant   442 KECEACIRPIYFGNFYSCLECDFILHEECANLSRKIHHPIHPHLLNLIGGFDGVINYYNDKCSAC 506

  Fly   756 IGVDQGQMSHDGQHWHATDECFSCNTCRCSLLGRAFLPRRGAIYCSIACSKGEPPTPSDSSGTGM 820
            ||:.:|...::                 |...|..|:       ..:.|:....|...:|....:
plant   507 IGLCKGGFFYE-----------------CGKQGCKFM-------LHVQCATTSEPLVHESHRHPL 547

  Fly   821 YTTPTPPTQRVR 832
            :.| :.|.:::|
plant   548 FLT-SKPGEKIR 558

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pkNP_724538.1 PET_Prickle 523..618 CDD:193602
LIM1_Prickle 624..682 CDD:188799 17/64 (27%)
LIM2_Prickle 687..742 CDD:188802 18/83 (22%)
LIM3_Prickle 747..805 CDD:188804 9/57 (16%)
AT2G28460NP_180413.2 C1_3 243..271 CDD:284959
C1_3 298..327 CDD:284959 3/9 (33%)
C1_2 353..384 CDD:281148 11/35 (31%)
C1_3 442..471 CDD:284959 8/28 (29%)
C1_2 610..639 CDD:281148
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.