DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pk and LIMS2

DIOPT Version :9

Sequence 1:NP_724538.1 Gene:pk / 45343 FlyBaseID:FBgn0003090 Length:1299 Species:Drosophila melanogaster
Sequence 2:NP_060450.2 Gene:LIMS2 / 55679 HGNCID:16084 Length:365 Species:Homo sapiens


Alignment Length:262 Identity:72/262 - (27%)
Similarity:103/262 - (39%) Gaps:55/262 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   554 PDDKVPYVNSPGEQYR-----VRQLLHQLPP---HDNEVR-YCHSLTDEERKELRLFSTQRKRDA 609
            |.:::  |||.||.|.     ..|.....|.   ::.|.| ||      |.....||:       
Human    48 PAERI--VNSNGELYHEHCFVCAQCFRPFPEGLFYEFEGRKYC------EHDFQMLFA------- 97

  Fly   610 LGRGNVRQLMSARPCDGCDDLISTGDIAVFATRLGPNASWHPACFACSVCRELLVDLIYFHRDGR 674
                         ||.|     |.|:..:.......|.:|||.||.|.:|...|.||.:....||
Human    98 -------------PCCG-----SCGEFIIGRVIKAMNNNWHPGCFRCELCDVELADLGFVKNAGR 144

  Fly   675 MYC----GRHHAETL-KPRCSACDEIILADECTEAEGRAWHMNHFACHECDKQLGGQRYIMREGK 734
            ..|    .|..|:.| |..|..| .:::.::.......|:|.:||.|..|.|:|..:...:: |:
Human   145 HLCRPCHNREKAKGLGKYICQRC-HLVIDEQPLMFRSDAYHPDHFNCTHCGKELTAEARELK-GE 207

  Fly   735 PYCLHCFDAMFAEYCDYCGEAIGVDQGQMSHD-GQHWHATDECFSCNTCRCSLLGRAFLPRRGAI 798
            .|||.|.|.|....|..|...|   :|::.:. |:.||.  |.|.|..|....||.....::|..
Human   208 LYCLPCHDKMGVPICGACRRPI---EGRVVNALGKQWHV--EHFVCAKCEKPFLGHRHYEKKGLA 267

  Fly   799 YC 800
            ||
Human   268 YC 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pkNP_724538.1 PET_Prickle 523..618 CDD:193602 16/72 (22%)
LIM1_Prickle 624..682 CDD:188799 19/61 (31%)
LIM2_Prickle 687..742 CDD:188802 15/54 (28%)
LIM3_Prickle 747..805 CDD:188804 16/55 (29%)
LIMS2NP_060450.2 LIM1_PINCH 39..97 CDD:188717 15/56 (27%)
LIM2_PINCH 100..151 CDD:188718 17/55 (31%)
LIM3_PINCH 164..214 CDD:188719 14/51 (27%)
LIM4_PINCH 220..273 CDD:188720 16/55 (29%)
LIM5_PINCH 281..334 CDD:188721
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.