DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pk and Lims1

DIOPT Version :9

Sequence 1:NP_724538.1 Gene:pk / 45343 FlyBaseID:FBgn0003090 Length:1299 Species:Drosophila melanogaster
Sequence 2:XP_017457250.1 Gene:Lims1 / 499443 RGDID:1560732 Length:407 Species:Rattus norvegicus


Alignment Length:306 Identity:74/306 - (24%)
Similarity:106/306 - (34%) Gaps:112/306 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   554 PDDKVPYVNSPGEQYRVR-----QLLHQLPP---HDNEVR-YC-HSLTDEERKELRLFSTQRKRD 608
            |.:|:  |||.||.|..:     |...|.|.   ::.|.| || |..                  
  Rat    90 PAEKI--VNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDF------------------ 134

  Fly   609 ALGRGNVRQLMSARPCDGCDDLISTGDIAVFATRLGPNASWHPACFACSVCRELLVD-------- 665
                    |::.|..|..|      |:..:.......|.||||.||.|.:|:|:|.|        
  Rat   135 --------QMLFAPCCHQC------GEFIIGRVIKAMNNSWHPECFRCDLCQEVLADIGFVKNAG 185

  Fly   666 --------------------------------LIY----FHRD-------------------GRM 675
                                            ||:    :|.|                   |.:
  Rat   186 RHLCRPCHNREKARGLGKYICQKCHAIIDEQPLIFKNDPYHPDHFNCANCGKELTADARELKGEL 250

  Fly   676 YCGRHHAETLKPRCSACDEIILADECTEAEGRAWHMNHFACHECDKQLGGQRYIMREGKPYCLHC 740
            ||...|.:...|.|.||...| ......|.|:.||:.||.|.:|:|...|.|:..|:|..||...
  Rat   251 YCLPCHDKMGVPICGACRRPI-EGRVVNAMGKQWHVEHFVCAKCEKPFLGHRHYERKGLAYCETH 314

  Fly   741 FDAMFAEYCDYCGEAIGVDQGQMSHDGQHWHATDECFSCNTCRCSL 786
            ::.:|.:.|.:|...|..|  .:|...:.|..:  ||:|:||...|
  Rat   315 YNQLFGDVCFHCNRVIEGD--VVSALNKAWCVS--CFACSTCNTKL 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pkNP_724538.1 PET_Prickle 523..618 CDD:193602 16/73 (22%)
LIM1_Prickle 624..682 CDD:188799 22/120 (18%)
LIM2_Prickle 687..742 CDD:188802 20/54 (37%)
LIM3_Prickle 747..805 CDD:188804 12/40 (30%)
Lims1XP_017457250.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.