DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pk and Lmcd1

DIOPT Version :9

Sequence 1:NP_724538.1 Gene:pk / 45343 FlyBaseID:FBgn0003090 Length:1299 Species:Drosophila melanogaster
Sequence 2:NP_001008562.1 Gene:Lmcd1 / 494021 RGDID:1308963 Length:365 Species:Rattus norvegicus


Alignment Length:242 Identity:87/242 - (35%)
Similarity:115/242 - (47%) Gaps:35/242 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   534 YTWVPPGLRPDQVRLYFSQIPDDKVPYVNSPGEQYRVRQLLHQLPPHDNEVRYCHSLTDEERKEL 598
            |.|.|||:.......|...||.:|.|...:.|..||.|||:||||.:|.:...|..|.:.|.|.:
  Rat   118 YEWAPPGVTQKLGLQYMELIPKEKQPVTGTEGALYRRRQLMHQLPIYDQDPSRCRGLVENELKAM 182

  Fly   599 RLFSTQRKRDALGRGNV-----------RQLMSARP------------------------CDGCD 628
            ..|..|.|.:|||.|.|           ......:|                        |:.|.
  Rat   183 EEFVKQYKSEALGVGEVALPG
QGGLPKEENKTQEKPEGTETTAPTTNGSLGDPSKEVEYVCELCK 247

  Fly   629 DLISTGDIAVFATRLGPNASWHPACFACSVCRELLVDLIYFHRDGRMYCGRHHAETLKPRCSACD 693
            .:.......|:|.|.|.:..|||.||.|..|.|.|||||||.:||..:||||:.|:|:||||.||
  Rat   248 GVAPADSPVVYADRAGYSKQWHPTCFLCIKCSEPLVDLIYFWKDGAPWCGRHY
CESLRPRCSGCD 312

  Fly   694 EIILADECTEAEGRAWHMNHFACHECDKQLGGQRYIMREGKPYCLHC 740
            |||.:::....|..|||..||.|..|::.|.|:.||:.:|:..|..|
  Rat   313 EIIFSEDYQRVEDLAWHRKHFICEGCEQLLSGRAYIITKGQLLCPTC 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pkNP_724538.1 PET_Prickle 523..618 CDD:193602 33/94 (35%)
LIM1_Prickle 624..682 CDD:188799 27/57 (47%)
LIM2_Prickle 687..742 CDD:188802 24/54 (44%)
LIM3_Prickle 747..805 CDD:188804
Lmcd1NP_001008562.1 PET_testin 116..203 CDD:193604 33/84 (39%)
LIM1_Testin_like 243..300 CDD:188726 26/56 (46%)
LIM 306..359 CDD:413332 23/52 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D422310at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X39
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.