DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pk and fhl5

DIOPT Version :9

Sequence 1:NP_724538.1 Gene:pk / 45343 FlyBaseID:FBgn0003090 Length:1299 Species:Drosophila melanogaster
Sequence 2:NP_001004112.1 Gene:fhl5 / 445475 ZFINID:ZDB-GENE-040822-3 Length:280 Species:Danio rerio


Alignment Length:156 Identity:55/156 - (35%)
Similarity:80/156 - (51%) Gaps:5/156 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   648 SWHPACFACSVCRELLVDLIYFHRDGRMYCGRHHAETLKPRCSACDEIILADECTEAEGRAWHMN 712
            |||..||.|..|::.:....:..:|...:|.....:....:|.||.:.|.....|..: :.||..
Zfish   122 SWHETCFLCQRCQQPIGTKSFIPKDNNYFCVPCFEKQ
FAYQCCACKKAITTGGVTYHD-KPWHRE 185

  Fly   713 HFACHECDKQLGGQRYIMREGKPYCLHCFDAMFAEYCDYCGEAIGVDQG--QMSHDGQHWHATDE 775
            .|.|..|.:||.|||:..||..||||.||..::|:.|..|.:||....|  .:|.:.:.||:  |
Zfish   186 CFTCIGCKRQLAGQRFTSRENYPYCLDCF
SNLYAKKCVGCTKAITSLAGAKYISFEERQWHS--E 248

  Fly   776 CFSCNTCRCSLLGRAFLPRRGAIYCS 801
            ||:|..|..||:||.||.:|..|.|:
Zfish   249 CFTCMQCSVSLVGRGFLTQRDDILCT 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pkNP_724538.1 PET_Prickle 523..618 CDD:193602
LIM1_Prickle 624..682 CDD:188799 9/33 (27%)
LIM2_Prickle 687..742 CDD:188802 22/54 (41%)
LIM3_Prickle 747..805 CDD:188804 22/57 (39%)
fhl5NP_001004112.1 LIM <6..34 CDD:295319
LIM1_FHL 37..95 CDD:188729
LIM 102..158 CDD:295319 9/35 (26%)
LIM3_FHL 163..214 CDD:188732 21/51 (41%)
LIM4_FHL 222..277 CDD:188733 22/55 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.